Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1749279..1750116 | Replicon | chromosome |
| Accession | NZ_CP099752 | ||
| Organism | Escherichia coli strain 806883-11-2019 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | NHF43_RS08515 | Protein ID | WP_000227784.1 |
| Coordinates | 1749574..1750116 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | NHF43_RS08510 | Protein ID | WP_001297137.1 |
| Coordinates | 1749279..1749590 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF43_RS08485 (1744299) | 1744299..1745246 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
| NHF43_RS08490 (1745268) | 1745268..1747259 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| NHF43_RS08495 (1747249) | 1747249..1747863 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| NHF43_RS08500 (1747863) | 1747863..1748192 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| NHF43_RS08505 (1748204) | 1748204..1749094 | + | 891 | WP_000971336.1 | heme o synthase | - |
| NHF43_RS08510 (1749279) | 1749279..1749590 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| NHF43_RS08515 (1749574) | 1749574..1750116 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| NHF43_RS08520 (1750172) | 1750172..1751107 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| NHF43_RS08525 (1751515) | 1751515..1752879 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| NHF43_RS08530 (1753007) | 1753007..1753498 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| NHF43_RS08535 (1753666) | 1753666..1754577 | + | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T249403 WP_000227784.1 NZ_CP099752:1749574-1750116 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|