Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1715202..1715820 | Replicon | chromosome |
Accession | NZ_CP099752 | ||
Organism | Escherichia coli strain 806883-11-2019 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NHF43_RS08345 | Protein ID | WP_001291435.1 |
Coordinates | 1715602..1715820 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NHF43_RS08340 | Protein ID | WP_112013726.1 |
Coordinates | 1715202..1715576 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF43_RS08330 (1710291) | 1710291..1711484 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NHF43_RS08335 (1711507) | 1711507..1714656 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NHF43_RS08340 (1715202) | 1715202..1715576 | + | 375 | WP_112013726.1 | Hha toxicity modulator TomB | Antitoxin |
NHF43_RS08345 (1715602) | 1715602..1715820 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NHF43_RS08350 (1715991) | 1715991..1716542 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NHF43_RS08355 (1716658) | 1716658..1717128 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NHF43_RS08360 (1717292) | 1717292..1718842 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NHF43_RS08365 (1718884) | 1718884..1719237 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NHF43_RS08375 (1719616) | 1719616..1719927 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NHF43_RS08380 (1719958) | 1719958..1720530 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T249402 WP_001291435.1 NZ_CP099752:1715602-1715820 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14587.48 Da Isoelectric Point: 4.7395
>AT249402 WP_112013726.1 NZ_CP099752:1715202-1715576 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNAMKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNAMKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|