Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 661764..662402 | Replicon | chromosome |
| Accession | NZ_CP099752 | ||
| Organism | Escherichia coli strain 806883-11-2019 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NHF43_RS03235 | Protein ID | WP_000813794.1 |
| Coordinates | 662226..662402 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NHF43_RS03230 | Protein ID | WP_001270285.1 |
| Coordinates | 661764..662180 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF43_RS03210 (656916) | 656916..657857 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NHF43_RS03215 (657858) | 657858..658871 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| NHF43_RS03220 (658889) | 658889..660034 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| NHF43_RS03225 (660279) | 660279..661685 | - | 1407 | WP_000760594.1 | PLP-dependent aminotransferase family protein | - |
| NHF43_RS03230 (661764) | 661764..662180 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NHF43_RS03235 (662226) | 662226..662402 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NHF43_RS03240 (662624) | 662624..662854 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NHF43_RS03245 (662946) | 662946..664907 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NHF43_RS03250 (664980) | 664980..665516 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NHF43_RS03255 (665608) | 665608..666783 | + | 1176 | WP_001236268.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 666823..667971 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T249401 WP_000813794.1 NZ_CP099752:c662402-662226 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT249401 WP_001270285.1 NZ_CP099752:c662180-661764 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|