Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 80868..81604 Replicon plasmid p806883-10-2019a
Accession NZ_CP099749
Organism Klebsiella pneumoniae strain 806883-10-2019

Toxin (Protein)


Gene name tacT Uniprot ID A0A142I508
Locus tag NHF42_RS26300 Protein ID WP_032720647.1
Coordinates 81122..81604 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NHF42_RS26295 Protein ID WP_003026799.1
Coordinates 80868..81134 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF42_RS26265 (NHF42_26250) 76413..77864 - 1452 WP_032720646.1 L-tyrosine/L-tryptophan isonitrile synthase family protein -
NHF42_RS26270 (NHF42_26255) 78107..79138 + 1032 WP_077255188.1 GlxA family transcriptional regulator -
NHF42_RS26275 (NHF42_26260) 79128..79225 + 98 Protein_87 hypothetical protein -
NHF42_RS26280 (NHF42_26265) 79189..79351 + 163 Protein_88 type I toxin-antitoxin system Hok family toxin -
NHF42_RS26285 (NHF42_26270) 79858..80145 - 288 WP_032720708.1 chorismate mutase -
NHF42_RS26290 (NHF42_26275) 80295..80741 - 447 WP_050548609.1 hypothetical protein -
NHF42_RS26295 (NHF42_26280) 80868..81134 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NHF42_RS26300 (NHF42_26285) 81122..81604 + 483 WP_032720647.1 GNAT family N-acetyltransferase Toxin
NHF42_RS26305 (NHF42_26290) 81812..82102 + 291 WP_168234253.1 helix-turn-helix domain-containing protein -
NHF42_RS26310 (NHF42_26295) 82062..82463 + 402 Protein_94 hypothetical protein -
NHF42_RS26315 (NHF42_26300) 82512..82907 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
NHF42_RS26320 (NHF42_26305) 83096..84493 + 1398 WP_260566392.1 ISNCY family transposase -
NHF42_RS26325 (NHF42_26310) 84619..85044 - 426 Protein_97 IS3 family transposase -
NHF42_RS26330 (NHF42_26315) 85049..85261 - 213 Protein_98 hypothetical protein -
NHF42_RS26335 (NHF42_26320) 85249..85518 - 270 WP_032720649.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..243395 243395


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17335.02 Da        Isoelectric Point: 9.8720

>T249392 WP_032720647.1 NZ_CP099749:81122-81604 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT249392 WP_003026799.1 NZ_CP099749:80868-81134 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A142I508

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References