Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 80868..81604 | Replicon | plasmid p806883-10-2019a |
| Accession | NZ_CP099749 | ||
| Organism | Klebsiella pneumoniae strain 806883-10-2019 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A142I508 |
| Locus tag | NHF42_RS26300 | Protein ID | WP_032720647.1 |
| Coordinates | 81122..81604 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NHF42_RS26295 | Protein ID | WP_003026799.1 |
| Coordinates | 80868..81134 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF42_RS26265 (NHF42_26250) | 76413..77864 | - | 1452 | WP_032720646.1 | L-tyrosine/L-tryptophan isonitrile synthase family protein | - |
| NHF42_RS26270 (NHF42_26255) | 78107..79138 | + | 1032 | WP_077255188.1 | GlxA family transcriptional regulator | - |
| NHF42_RS26275 (NHF42_26260) | 79128..79225 | + | 98 | Protein_87 | hypothetical protein | - |
| NHF42_RS26280 (NHF42_26265) | 79189..79351 | + | 163 | Protein_88 | type I toxin-antitoxin system Hok family toxin | - |
| NHF42_RS26285 (NHF42_26270) | 79858..80145 | - | 288 | WP_032720708.1 | chorismate mutase | - |
| NHF42_RS26290 (NHF42_26275) | 80295..80741 | - | 447 | WP_050548609.1 | hypothetical protein | - |
| NHF42_RS26295 (NHF42_26280) | 80868..81134 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NHF42_RS26300 (NHF42_26285) | 81122..81604 | + | 483 | WP_032720647.1 | GNAT family N-acetyltransferase | Toxin |
| NHF42_RS26305 (NHF42_26290) | 81812..82102 | + | 291 | WP_168234253.1 | helix-turn-helix domain-containing protein | - |
| NHF42_RS26310 (NHF42_26295) | 82062..82463 | + | 402 | Protein_94 | hypothetical protein | - |
| NHF42_RS26315 (NHF42_26300) | 82512..82907 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| NHF42_RS26320 (NHF42_26305) | 83096..84493 | + | 1398 | WP_260566392.1 | ISNCY family transposase | - |
| NHF42_RS26325 (NHF42_26310) | 84619..85044 | - | 426 | Protein_97 | IS3 family transposase | - |
| NHF42_RS26330 (NHF42_26315) | 85049..85261 | - | 213 | Protein_98 | hypothetical protein | - |
| NHF42_RS26335 (NHF42_26320) | 85249..85518 | - | 270 | WP_032720649.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..243395 | 243395 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.02 Da Isoelectric Point: 9.8720
>T249392 WP_032720647.1 NZ_CP099749:81122-81604 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A142I508 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |