Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 40310..40953 | Replicon | plasmid p806883-10-2019a |
Accession | NZ_CP099749 | ||
Organism | Klebsiella pneumoniae strain 806883-10-2019 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | NHF42_RS26045 | Protein ID | WP_044266737.1 |
Coordinates | 40537..40953 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | G8LQB1 |
Locus tag | NHF42_RS26040 | Protein ID | WP_007853351.1 |
Coordinates | 40310..40540 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHF42_RS26010 (NHF42_25995) | 35942..36978 | - | 1037 | Protein_34 | lasso peptide isopeptide bond-forming cyclase | - |
NHF42_RS26015 (NHF42_26000) | 37012..37980 | + | 969 | WP_004099053.1 | IS5-like element IS903B family transposase | - |
NHF42_RS26020 (NHF42_26005) | 38035..38595 | - | 561 | Protein_36 | lasso peptide isopeptide bond-forming cyclase | - |
NHF42_RS26025 (NHF42_26010) | 38596..39213 | - | 618 | WP_260566387.1 | lasso peptide biosynthesis B2 protein | - |
NHF42_RS26030 (NHF42_26015) | 39282..39419 | - | 138 | WP_023341729.1 | lasso peptide klebsidin | - |
NHF42_RS26035 (NHF42_26020) | 40160..40353 | - | 194 | Protein_39 | hypothetical protein | - |
NHF42_RS26040 (NHF42_26025) | 40310..40540 | + | 231 | WP_007853351.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NHF42_RS26045 (NHF42_26030) | 40537..40953 | + | 417 | WP_044266737.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NHF42_RS26050 (NHF42_26035) | 41112..43250 | - | 2139 | WP_260566388.1 | AAA family ATPase | - |
NHF42_RS26055 (NHF42_26040) | 44033..45235 | - | 1203 | WP_260566389.1 | arabinose transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..243395 | 243395 | |
- | flank | IS/Tn | - | - | 45260..46183 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15121.55 Da Isoelectric Point: 7.8882
>T249390 WP_044266737.1 NZ_CP099749:40537-40953 [Klebsiella pneumoniae]
VNRIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCTRLDAILPWDRA
AVDATTEIKVALRLAGTPIGANDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
VNRIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCTRLDAILPWDRA
AVDATTEIKVALRLAGTPIGANDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|