Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4707020..4707723 | Replicon | chromosome |
| Accession | NZ_CP099748 | ||
| Organism | Klebsiella pneumoniae strain 806883-10-2019 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | NHF42_RS22790 | Protein ID | WP_040196446.1 |
| Coordinates | 4707020..4707361 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NHF42_RS22795 | Protein ID | WP_040196448.1 |
| Coordinates | 4707382..4707723 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF42_RS22765 (NHF42_22750) | 4703597..4704724 | + | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
| NHF42_RS22770 (NHF42_22755) | 4704714..4704977 | + | 264 | WP_004192273.1 | hypothetical protein | - |
| NHF42_RS22775 (NHF42_22760) | 4705123..4705257 | + | 135 | Protein_4466 | transposase | - |
| NHF42_RS22780 (NHF42_22765) | 4705270..4705380 | - | 111 | Protein_4467 | DUF4102 domain-containing protein | - |
| NHF42_RS22785 (NHF42_22770) | 4705755..4706762 | - | 1008 | WP_004216518.1 | restriction endonuclease | - |
| NHF42_RS22790 (NHF42_22775) | 4707020..4707361 | - | 342 | WP_040196446.1 | TA system toxin CbtA family protein | Toxin |
| NHF42_RS22795 (NHF42_22780) | 4707382..4707723 | - | 342 | WP_040196448.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NHF42_RS22800 (NHF42_22785) | 4707734..4708276 | - | 543 | WP_004894621.1 | DNA repair protein RadC | - |
| NHF42_RS22805 (NHF42_22790) | 4708289..4708732 | - | 444 | WP_004894623.1 | antirestriction protein | - |
| NHF42_RS22810 (NHF42_22795) | 4708763..4709584 | - | 822 | WP_040196452.1 | DUF932 domain-containing protein | - |
| NHF42_RS22815 (NHF42_22800) | 4709683..4709913 | - | 231 | WP_014226751.1 | DUF905 domain-containing protein | - |
| NHF42_RS22820 (NHF42_22805) | 4709985..4710434 | - | 450 | WP_004215773.1 | IrmA family protein | - |
| NHF42_RS22825 (NHF42_22810) | 4710431..4710883 | - | 453 | WP_040196455.1 | hypothetical protein | - |
| NHF42_RS22830 (NHF42_22815) | 4710920..4711489 | - | 570 | WP_260566371.1 | hypothetical protein | - |
| NHF42_RS22835 (NHF42_22820) | 4711489..4712193 | - | 705 | WP_040196458.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4699481..4746762 | 47281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12791.74 Da Isoelectric Point: 7.1648
>T249387 WP_040196446.1 NZ_CP099748:c4707361-4707020 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|