Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4066279..4066898 Replicon chromosome
Accession NZ_CP099748
Organism Klebsiella pneumoniae strain 806883-10-2019

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NHF42_RS19715 Protein ID WP_002892050.1
Coordinates 4066680..4066898 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NHF42_RS19710 Protein ID WP_002892066.1
Coordinates 4066279..4066653 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF42_RS19700 (NHF42_19690) 4061431..4062624 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NHF42_RS19705 (NHF42_19695) 4062647..4065793 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NHF42_RS19710 (NHF42_19700) 4066279..4066653 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NHF42_RS19715 (NHF42_19705) 4066680..4066898 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NHF42_RS19720 (NHF42_19710) 4067057..4067623 + 567 WP_002892030.1 maltose O-acetyltransferase -
NHF42_RS19725 (NHF42_19715) 4067595..4067735 - 141 WP_032409038.1 hypothetical protein -
NHF42_RS19730 (NHF42_19720) 4067756..4068226 + 471 WP_002892026.1 YlaC family protein -
NHF42_RS19735 (NHF42_19725) 4068201..4069652 - 1452 WP_260565854.1 PLP-dependent aminotransferase family protein -
NHF42_RS19740 (NHF42_19730) 4069753..4070451 + 699 WP_004893822.1 GNAT family protein -
NHF42_RS19745 (NHF42_19735) 4070448..4070588 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NHF42_RS19750 (NHF42_19740) 4070588..4070851 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T249385 WP_002892050.1 NZ_CP099748:4066680-4066898 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT249385 WP_002892066.1 NZ_CP099748:4066279-4066653 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References