Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 79803..80539 Replicon plasmid p503666-2-2019a
Accession NZ_CP099744
Organism Klebsiella pneumoniae strain 503666-2-2019

Toxin (Protein)


Gene name tacT Uniprot ID A0A142I508
Locus tag NHF44_RS26120 Protein ID WP_032720647.1
Coordinates 80057..80539 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NHF44_RS26115 Protein ID WP_003026799.1
Coordinates 79803..80069 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF44_RS26085 (NHF44_26070) 75348..76799 - 1452 WP_032720646.1 L-tyrosine/L-tryptophan isonitrile synthase family protein -
NHF44_RS26090 (NHF44_26075) 77042..78073 + 1032 WP_077255188.1 GlxA family transcriptional regulator -
NHF44_RS26095 (NHF44_26080) 78063..78160 + 98 Protein_85 hypothetical protein -
NHF44_RS26100 (NHF44_26085) 78124..78286 + 163 Protein_86 type I toxin-antitoxin system Hok family toxin -
NHF44_RS26105 (NHF44_26090) 78793..79080 - 288 WP_032720708.1 chorismate mutase -
NHF44_RS26110 (NHF44_26095) 79230..79676 - 447 WP_050548609.1 hypothetical protein -
NHF44_RS26115 (NHF44_26100) 79803..80069 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NHF44_RS26120 (NHF44_26105) 80057..80539 + 483 WP_032720647.1 GNAT family N-acetyltransferase Toxin
NHF44_RS26125 (NHF44_26110) 80747..81037 + 291 WP_168234253.1 helix-turn-helix domain-containing protein -
NHF44_RS26130 (NHF44_26115) 80997..81398 + 402 Protein_92 hypothetical protein -
NHF44_RS26135 (NHF44_26120) 81447..81842 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
NHF44_RS26140 (NHF44_26125) 82031..83428 + 1398 WP_260566392.1 ISNCY family transposase -
NHF44_RS26145 (NHF44_26130) 83554..83979 - 426 Protein_95 IS3 family transposase -
NHF44_RS26150 (NHF44_26135) 83984..84196 - 213 Protein_96 hypothetical protein -
NHF44_RS26155 (NHF44_26140) 84184..84453 - 270 WP_032720649.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..243656 243656


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17335.02 Da        Isoelectric Point: 9.8720

>T249373 WP_032720647.1 NZ_CP099744:80057-80539 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT249373 WP_003026799.1 NZ_CP099744:79803-80069 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A142I508

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References