Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4668024..4668727 | Replicon | chromosome |
| Accession | NZ_CP099743 | ||
| Organism | Klebsiella pneumoniae strain 503666-2-2019 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | NHF44_RS22620 | Protein ID | WP_040196446.1 |
| Coordinates | 4668024..4668365 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NHF44_RS22625 | Protein ID | WP_040196448.1 |
| Coordinates | 4668386..4668727 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHF44_RS22595 (NHF44_22580) | 4664601..4665728 | + | 1128 | WP_023325431.1 | PAAR domain-containing protein | - |
| NHF44_RS22600 (NHF44_22585) | 4665718..4665981 | + | 264 | WP_004192273.1 | hypothetical protein | - |
| NHF44_RS22605 (NHF44_22590) | 4666127..4666261 | + | 135 | Protein_4432 | transposase | - |
| NHF44_RS22610 (NHF44_22595) | 4666274..4666384 | - | 111 | Protein_4433 | DUF4102 domain-containing protein | - |
| NHF44_RS22615 (NHF44_22600) | 4666759..4667766 | - | 1008 | WP_004216518.1 | restriction endonuclease | - |
| NHF44_RS22620 (NHF44_22605) | 4668024..4668365 | - | 342 | WP_040196446.1 | TA system toxin CbtA family protein | Toxin |
| NHF44_RS22625 (NHF44_22610) | 4668386..4668727 | - | 342 | WP_040196448.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NHF44_RS22630 (NHF44_22615) | 4668738..4669280 | - | 543 | WP_004894621.1 | DNA repair protein RadC | - |
| NHF44_RS22635 (NHF44_22620) | 4669293..4669736 | - | 444 | WP_004894623.1 | antirestriction protein | - |
| NHF44_RS22640 (NHF44_22625) | 4669767..4670588 | - | 822 | WP_040196452.1 | DUF932 domain-containing protein | - |
| NHF44_RS22645 (NHF44_22630) | 4670687..4670917 | - | 231 | WP_014226751.1 | DUF905 domain-containing protein | - |
| NHF44_RS22650 (NHF44_22635) | 4670989..4671438 | - | 450 | WP_004215773.1 | IrmA family protein | - |
| NHF44_RS22655 (NHF44_22640) | 4671435..4671887 | - | 453 | WP_040196455.1 | hypothetical protein | - |
| NHF44_RS22660 (NHF44_22645) | 4671924..4672493 | - | 570 | WP_260566371.1 | hypothetical protein | - |
| NHF44_RS22665 (NHF44_22650) | 4672493..4673197 | - | 705 | WP_040196458.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4660485..4707766 | 47281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12791.74 Da Isoelectric Point: 7.1648
>T249368 WP_040196446.1 NZ_CP099743:c4668365-4668024 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
MKTLPATTPQAVTLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYELVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|