Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4027283..4027902 Replicon chromosome
Accession NZ_CP099743
Organism Klebsiella pneumoniae strain 503666-2-2019

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NHF44_RS19545 Protein ID WP_002892050.1
Coordinates 4027684..4027902 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NHF44_RS19540 Protein ID WP_002892066.1
Coordinates 4027283..4027657 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHF44_RS19530 (NHF44_19520) 4022435..4023628 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NHF44_RS19535 (NHF44_19525) 4023651..4026797 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NHF44_RS19540 (NHF44_19530) 4027283..4027657 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NHF44_RS19545 (NHF44_19535) 4027684..4027902 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NHF44_RS19550 (NHF44_19540) 4028061..4028627 + 567 WP_002892030.1 maltose O-acetyltransferase -
NHF44_RS19555 (NHF44_19545) 4028599..4028739 - 141 WP_032409038.1 hypothetical protein -
NHF44_RS19560 (NHF44_19550) 4028760..4029230 + 471 WP_002892026.1 YlaC family protein -
NHF44_RS19565 (NHF44_19555) 4029205..4030656 - 1452 WP_260565854.1 PLP-dependent aminotransferase family protein -
NHF44_RS19570 (NHF44_19560) 4030757..4031455 + 699 WP_004893822.1 GNAT family protein -
NHF44_RS19575 (NHF44_19565) 4031452..4031592 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NHF44_RS19580 (NHF44_19570) 4031592..4031855 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T249366 WP_002892050.1 NZ_CP099743:4027684-4027902 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT249366 WP_002892066.1 NZ_CP099743:4027283-4027657 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References