Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 7561..9120 | Replicon | plasmid unnamed1 |
Accession | NZ_CP099736 | ||
Organism | Photobacterium sp. TY1-4 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | NH461_RS25390 | Protein ID | WP_261604673.1 |
Coordinates | 7813..9120 (+) | Length | 436 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | NH461_RS25385 | Protein ID | WP_261604672.1 |
Coordinates | 7561..7812 (+) | Length | 84 a.a. |
Genomic Context
Location: 2978..3946 (969 bp)
Type: Others
Protein ID: WP_261604669.1
Type: Others
Protein ID: WP_261604669.1
Location: 5779..7425 (1647 bp)
Type: Others
Protein ID: WP_261604671.1
Type: Others
Protein ID: WP_261604671.1
Location: 7561..7812 (252 bp)
Type: Antitoxin
Protein ID: WP_261604672.1
Type: Antitoxin
Protein ID: WP_261604672.1
Location: 7813..9120 (1308 bp)
Type: Toxin
Protein ID: WP_261604673.1
Type: Toxin
Protein ID: WP_261604673.1
Location: 4013..5233 (1221 bp)
Type: Others
Protein ID: WP_261604670.1
Type: Others
Protein ID: WP_261604670.1
Location: 9287..10249 (963 bp)
Type: Others
Protein ID: WP_261604674.1
Type: Others
Protein ID: WP_261604674.1
Location: 10407..11144 (738 bp)
Type: Others
Protein ID: WP_261604675.1
Type: Others
Protein ID: WP_261604675.1
Location: 11137..11637 (501 bp)
Type: Others
Protein ID: WP_261604676.1
Type: Others
Protein ID: WP_261604676.1
Location: 12121..12942 (822 bp)
Type: Others
Protein ID: WP_261604677.1
Type: Others
Protein ID: WP_261604677.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH461_RS25370 (NH461_25295) | 2978..3946 | + | 969 | WP_261604669.1 | ParB family protein | - |
NH461_RS25375 (NH461_25300) | 4013..5233 | - | 1221 | WP_261604670.1 | PD-(D/E)XK nuclease family protein | - |
NH461_RS25380 (NH461_25305) | 5779..7425 | + | 1647 | WP_261604671.1 | hypothetical protein | - |
NH461_RS25385 (NH461_25310) | 7561..7812 | + | 252 | WP_261604672.1 | helix-turn-helix domain-containing protein | Antitoxin |
NH461_RS25390 (NH461_25315) | 7813..9120 | + | 1308 | WP_261604673.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
NH461_RS25395 (NH461_25320) | 9287..10249 | - | 963 | WP_261604674.1 | reverse transcriptase family protein | - |
NH461_RS25400 (NH461_25325) | 10407..11144 | - | 738 | WP_261604675.1 | hypothetical protein | - |
NH461_RS25405 (NH461_25330) | 11137..11637 | - | 501 | WP_261604676.1 | hypothetical protein | - |
NH461_RS25410 (NH461_25335) | 12121..12942 | - | 822 | WP_261604677.1 | DUF2182 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..61276 | 61276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 436 a.a. Molecular weight: 47782.13 Da Isoelectric Point: 7.8526
>T249356 WP_261604673.1 NZ_CP099736:7813-9120 [Photobacterium sp. TY1-4]
MADLTIAMNGYPIGTLHRSPSGAHEFGYDESWLNTPGARPISLSLPLGRRRFKGEVVYNFFDNLLPDNMQIRQRIVARHH
AASSQPFDLLAEIGMDCVGALQIYPSRRQPEAVRTIHCKALDDTALRNILLGYRVDAPLGMISSEADFRISIAGAQEKTA
LLRQNGQWYLPLGSTPTTHILKLPIGAIQSPSHTIDLSASVENELVCLRLAAALGLPVAEAEMLTVGDIRALSVTRFDRR
LASDGQWIMRLPQEDFCQVLGVSPGLKYESDGGPGIVEIMTYLLGSVHPELDRATFMRAQVVFWLLAATDGHAKNFSVYL
LPDGAFRLTPLYDILSVYPVMGGAGLSERKVKMAMGLHGSKGRHYKWYSIFPRHFLATARAAGFDETAMQAILDEVRDKV
PAAVASVRASLPADFPAKISEAIFAGLLKRAQRMD
MADLTIAMNGYPIGTLHRSPSGAHEFGYDESWLNTPGARPISLSLPLGRRRFKGEVVYNFFDNLLPDNMQIRQRIVARHH
AASSQPFDLLAEIGMDCVGALQIYPSRRQPEAVRTIHCKALDDTALRNILLGYRVDAPLGMISSEADFRISIAGAQEKTA
LLRQNGQWYLPLGSTPTTHILKLPIGAIQSPSHTIDLSASVENELVCLRLAAALGLPVAEAEMLTVGDIRALSVTRFDRR
LASDGQWIMRLPQEDFCQVLGVSPGLKYESDGGPGIVEIMTYLLGSVHPELDRATFMRAQVVFWLLAATDGHAKNFSVYL
LPDGAFRLTPLYDILSVYPVMGGAGLSERKVKMAMGLHGSKGRHYKWYSIFPRHFLATARAAGFDETAMQAILDEVRDKV
PAAVASVRASLPADFPAKISEAIFAGLLKRAQRMD
Download Length: 1308 bp