Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 1721493..1722049 | Replicon | chromosome |
| Accession | NZ_CP099735 | ||
| Organism | Photobacterium sp. TY1-4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NH461_RS24475 | Protein ID | WP_261603562.1 |
| Coordinates | 1721738..1722049 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NH461_RS24470 | Protein ID | WP_261603561.1 |
| Coordinates | 1721493..1721750 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH461_RS24440 (NH461_24370) | 1716696..1717214 | + | 519 | WP_261603555.1 | cysteine hydrolase family protein | - |
| NH461_RS24445 (NH461_24375) | 1717338..1717955 | - | 618 | WP_261603556.1 | SCO family protein | - |
| NH461_RS24450 (NH461_24380) | 1717948..1718349 | - | 402 | WP_261603557.1 | hypothetical protein | - |
| NH461_RS24455 (NH461_24385) | 1718342..1718911 | - | 570 | WP_261603558.1 | hypothetical protein | - |
| NH461_RS24460 (NH461_24390) | 1718922..1720103 | - | 1182 | WP_261603559.1 | MFS transporter | - |
| NH461_RS24465 (NH461_24395) | 1720284..1721258 | + | 975 | WP_261603560.1 | LysR family transcriptional regulator | - |
| NH461_RS24470 (NH461_24400) | 1721493..1721750 | + | 258 | WP_261603561.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NH461_RS24475 (NH461_24405) | 1721738..1722049 | + | 312 | WP_261603562.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NH461_RS24480 (NH461_24410) | 1722152..1722562 | - | 411 | WP_261604628.1 | VF530 family DNA-binding protein | - |
| NH461_RS24485 (NH461_24415) | 1722782..1723711 | + | 930 | WP_261603563.1 | hypothetical protein | - |
| NH461_RS24490 (NH461_24420) | 1723967..1724419 | + | 453 | WP_261603564.1 | TlpA disulfide reductase family protein | - |
| NH461_RS24495 (NH461_24425) | 1724495..1725748 | + | 1254 | WP_261603565.1 | sialidase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11876.71 Da Isoelectric Point: 4.8893
>T249355 WP_261603562.1 NZ_CP099735:1721738-1722049 [Photobacterium sp. TY1-4]
MAEVIWTDPALSDLNETAEYIALDNLVAAKLLVQSVFEKVERLELFPGSGRVPPELQHLSYREVVVSLCRVFYKQEGDKV
FILHVMREERDLRKFLLSQQSSP
MAEVIWTDPALSDLNETAEYIALDNLVAAKLLVQSVFEKVERLELFPGSGRVPPELQHLSYREVVVSLCRVFYKQEGDKV
FILHVMREERDLRKFLLSQQSSP
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|