Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-yefM/YoeB-RelB |
| Location | 579677..580205 | Replicon | chromosome |
| Accession | NZ_CP099735 | ||
| Organism | Photobacterium sp. TY1-4 | ||
Toxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NH461_RS19310 | Protein ID | WP_261604229.1 |
| Coordinates | 579677..579958 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | NH461_RS19315 | Protein ID | WP_261604230.1 |
| Coordinates | 579951..580205 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH461_RS19280 (NH461_19230) | 576518..576841 | - | 324 | WP_261604224.1 | hypothetical protein | - |
| NH461_RS19285 (NH461_19235) | 576916..577377 | - | 462 | WP_261604225.1 | hypothetical protein | - |
| NH461_RS19290 (NH461_19240) | 577540..578010 | - | 471 | WP_261604226.1 | hypothetical protein | - |
| NH461_RS19295 (NH461_19245) | 578137..578622 | - | 486 | WP_261604227.1 | GNAT family N-acetyltransferase | - |
| NH461_RS19300 (NH461_19250) | 578786..579286 | - | 501 | WP_261604228.1 | GNAT family N-acetyltransferase | - |
| NH461_RS19305 (NH461_19255) | 579387..579536 | + | 150 | Protein_550 | IS110 family transposase | - |
| NH461_RS19310 (NH461_19260) | 579677..579958 | - | 282 | WP_261604229.1 | Txe/YoeB family addiction module toxin | Toxin |
| NH461_RS19315 (NH461_19265) | 579951..580205 | - | 255 | WP_261604230.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NH461_RS19320 (NH461_19270) | 580393..580660 | + | 268 | Protein_553 | IS110 family transposase | - |
| NH461_RS19325 (NH461_19275) | 580866..582461 | - | 1596 | WP_261604231.1 | hypothetical protein | - |
| NH461_RS19330 (NH461_19280) | 582577..582972 | - | 396 | WP_261604232.1 | hypothetical protein | - |
| NH461_RS19335 (NH461_19285) | 583048..583369 | + | 322 | Protein_556 | hypothetical protein | - |
| NH461_RS19340 (NH461_19290) | 583692..584123 | - | 432 | WP_261604233.1 | hypothetical protein | - |
| NH461_RS19345 (NH461_19295) | 584281..584806 | + | 526 | Protein_558 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 177987..610045 | 432058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11012.50 Da Isoelectric Point: 8.0108
>T249354 WP_261604229.1 NZ_CP099735:c579958-579677 [Photobacterium sp. TY1-4]
MSRMLAWTDAAWTDAAWDDYLYWQSQDKKTLKRINKLIVDTKRSPFEGIGKPEALKENLSGFWSRRIDESNRLVYAVDNI
HITIISCRYHYEA
MSRMLAWTDAAWTDAAWDDYLYWQSQDKKTLKRINKLIVDTKRSPFEGIGKPEALKENLSGFWSRRIDESNRLVYAVDNI
HITIISCRYHYEA
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|