Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 2849846..2850477 | Replicon | chromosome |
Accession | NZ_CP099734 | ||
Organism | Photobacterium sp. TY1-4 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | NH461_RS13335 | Protein ID | WP_261600819.1 |
Coordinates | 2849846..2850232 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | NH461_RS13340 | Protein ID | WP_261600820.1 |
Coordinates | 2850232..2850477 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH461_RS13300 (NH461_13270) | 2845233..2845589 | + | 357 | WP_261600814.1 | outer membrane protein assembly factor BamE | - |
NH461_RS13305 (NH461_13275) | 2845706..2846053 | - | 348 | WP_261600815.1 | RnfH family protein | - |
NH461_RS13310 (NH461_13280) | 2846043..2846477 | - | 435 | WP_261600816.1 | SRPBCC family protein | - |
NH461_RS13315 (NH461_13285) | 2846673..2847155 | + | 483 | WP_261600817.1 | SsrA-binding protein SmpB | - |
NH461_RS13325 (NH461_13295) | 2847688..2848643 | - | 956 | Protein_2534 | HipA domain-containing protein | - |
NH461_RS13335 (NH461_13305) | 2849846..2850232 | - | 387 | WP_261600819.1 | HipA N-terminal domain-containing protein | Toxin |
NH461_RS13340 (NH461_13310) | 2850232..2850477 | - | 246 | WP_261600820.1 | type II toxin-antitoxin system antitoxin HipB | Antitoxin |
NH461_RS13345 (NH461_13315) | 2850774..2851307 | + | 534 | WP_261600821.1 | hypothetical protein | - |
NH461_RS13350 (NH461_13320) | 2851331..2853352 | + | 2022 | WP_261600822.1 | DNA phosphorothioation-associated putative methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2848639..2857148 | 8509 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14675.72 Da Isoelectric Point: 5.2301
>T249353 WP_261600819.1 NZ_CP099734:c2850232-2849846 [Photobacterium sp. TY1-4]
MASLIAYMNGECVGKLIKLADGAHHFQYAEEWIESPRGRPLSLSLPLQYQKLTSNCVINYFDNLLPDLNEIRDRIVARYN
ADSRQAFDLLKQVGKDSVGAISLHMPEERPAPKQLEYEVLDDRRLKDE
MASLIAYMNGECVGKLIKLADGAHHFQYAEEWIESPRGRPLSLSLPLQYQKLTSNCVINYFDNLLPDLNEIRDRIVARYN
ADSRQAFDLLKQVGKDSVGAISLHMPEERPAPKQLEYEVLDDRRLKDE
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|