Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1574475..1575003 | Replicon | chromosome |
| Accession | NZ_CP099734 | ||
| Organism | Photobacterium sp. TY1-4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NH461_RS07400 | Protein ID | WP_261602592.1 |
| Coordinates | 1574713..1575003 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A193KIL6 |
| Locus tag | NH461_RS07395 | Protein ID | WP_017028225.1 |
| Coordinates | 1574475..1574723 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH461_RS07375 (NH461_07365) | 1570063..1570566 | - | 504 | WP_261602589.1 | DUF4174 domain-containing protein | - |
| NH461_RS07380 (NH461_07370) | 1570750..1571676 | - | 927 | WP_261602590.1 | LysR family transcriptional regulator | - |
| NH461_RS07385 (NH461_07375) | 1571863..1573056 | + | 1194 | WP_261602591.1 | glycine C-acetyltransferase | - |
| NH461_RS07390 (NH461_07380) | 1573176..1574207 | + | 1032 | WP_255390276.1 | L-threonine 3-dehydrogenase | - |
| NH461_RS07395 (NH461_07385) | 1574475..1574723 | + | 249 | WP_017028225.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NH461_RS07400 (NH461_07390) | 1574713..1575003 | + | 291 | WP_261602592.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NH461_RS07405 (NH461_07395) | 1575051..1575491 | + | 441 | WP_261602593.1 | DUF4113 domain-containing protein | - |
| NH461_RS07410 (NH461_07400) | 1575841..1576155 | + | 315 | WP_261602594.1 | hypothetical protein | - |
| NH461_RS07415 (NH461_07405) | 1576272..1577174 | + | 903 | WP_261602595.1 | hypothetical protein | - |
| NH461_RS07420 (NH461_07410) | 1577313..1578086 | - | 774 | WP_261602596.1 | IS21-like element helper ATPase IstB | - |
| NH461_RS07425 (NH461_07415) | 1578207..1579282 | + | 1076 | WP_261602597.1 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1570750..1584509 | 13759 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11222.28 Da Isoelectric Point: 10.6832
>T249352 WP_261602592.1 NZ_CP099734:1574713-1575003 [Photobacterium sp. TY1-4]
MTYKLDFKKSALKEWKKLGSTLQQMFKKKLIERLENPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVVIVTVLAVGK
RERSDVYRKAMKRSDV
MTYKLDFKKSALKEWKKLGSTLQQMFKKKLIERLENPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDDVVIVTVLAVGK
RERSDVYRKAMKRSDV
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|