Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
| Location | 1309305..1309870 | Replicon | chromosome |
| Accession | NZ_CP099734 | ||
| Organism | Photobacterium sp. TY1-4 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NH461_RS06255 | Protein ID | WP_261602386.1 |
| Coordinates | 1309583..1309870 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NH461_RS06250 | Protein ID | WP_261602385.1 |
| Coordinates | 1309305..1309586 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH461_RS06220 (NH461_06210) | 1305328..1305705 | + | 378 | WP_261602382.1 | hypothetical protein | - |
| NH461_RS06225 (NH461_06215) | 1305947..1306259 | - | 313 | Protein_1135 | IS110 family transposase | - |
| NH461_RS06230 (NH461_06220) | 1306363..1306788 | + | 426 | WP_261602383.1 | GNAT family N-acetyltransferase | - |
| NH461_RS06235 (NH461_06225) | 1307009..1307298 | - | 290 | Protein_1137 | IS110 family transposase | - |
| NH461_RS06240 (NH461_06230) | 1307422..1308633 | - | 1212 | WP_261602384.1 | hypothetical protein | - |
| NH461_RS06245 (NH461_06235) | 1308953..1309204 | - | 252 | Protein_1139 | transposase | - |
| NH461_RS06250 (NH461_06240) | 1309305..1309586 | + | 282 | WP_261602385.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NH461_RS06255 (NH461_06245) | 1309583..1309870 | + | 288 | WP_261602386.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NH461_RS06260 (NH461_06250) | 1309950..1310579 | - | 630 | WP_261602387.1 | TetR/AcrR family transcriptional regulator | - |
| NH461_RS06265 (NH461_06255) | 1310800..1312386 | - | 1587 | Protein_1143 | ABC transporter ATP-binding protein/permease | - |
| NH461_RS06270 (NH461_06260) | 1312383..1314026 | - | 1644 | WP_261602388.1 | ABC transporter ATP-binding protein | - |
| NH461_RS06275 (NH461_06265) | 1314318..1314602 | - | 285 | WP_261602389.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1297697..1316046 | 18349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10904.53 Da Isoelectric Point: 4.5950
>T249351 WP_261602386.1 NZ_CP099734:1309583-1309870 [Photobacterium sp. TY1-4]
MKVVWSPLALQKLGDAAEFISLDNPAAAGNWVNEVFDQTELLGTMPEMGRMVPEMPDTHYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILTEDDV
MKVVWSPLALQKLGDAAEFISLDNPAAAGNWVNEVFDQTELLGTMPEMGRMVPEMPDTHYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILTEDDV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|