Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 5393104..5393987 | Replicon | chromosome |
Accession | NZ_CP099727 | ||
Organism | Pseudomonas putida strain PCL1760 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NH673_RS24315 | Protein ID | WP_230064417.1 |
Coordinates | 5393104..5393490 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A524BX56 |
Locus tag | NH673_RS24320 | Protein ID | WP_014591577.1 |
Coordinates | 5393538..5393987 (-) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH673_RS24295 (NH673_24295) | 5388242..5389306 | + | 1065 | WP_014591573.1 | TerC family protein | - |
NH673_RS24300 (NH673_24300) | 5389402..5390631 | - | 1230 | WP_003250533.1 | acyl-CoA dehydrogenase | - |
NH673_RS24305 (NH673_24305) | 5390772..5391698 | + | 927 | WP_014591574.1 | LysR family transcriptional regulator | - |
NH673_RS24310 (NH673_24310) | 5391892..5393046 | + | 1155 | Protein_4791 | aminotransferase class V-fold PLP-dependent enzyme | - |
NH673_RS24315 (NH673_24315) | 5393104..5393490 | - | 387 | WP_230064417.1 | RES family NAD+ phosphorylase | Toxin |
NH673_RS24320 (NH673_24320) | 5393538..5393987 | - | 450 | WP_014591577.1 | DUF2384 domain-containing protein | Antitoxin |
NH673_RS24325 (NH673_24325) | 5394129..5394782 | - | 654 | WP_014591578.1 | oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB | - |
NH673_RS24330 (NH673_24330) | 5394886..5395809 | + | 924 | WP_019438774.1 | LysR family transcriptional regulator | - |
NH673_RS24335 (NH673_24335) | 5395858..5396688 | + | 831 | WP_003250518.1 | AraC family transcriptional regulator | - |
NH673_RS24340 (NH673_24340) | 5396739..5397323 | + | 585 | WP_014591580.1 | LysE family transporter | - |
NH673_RS24345 (NH673_24345) | 5397363..5398562 | - | 1200 | WP_014591581.1 | sugar transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14201.23 Da Isoelectric Point: 5.5882
>T249350 WP_230064417.1 NZ_CP099727:c5393490-5393104 [Pseudomonas putida]
MRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQPGWSAQPELTRTLGNRF
LDDGSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
MRVSGRWHQAGRPVVYAATSPPGAMLEVLVHLEIDPEDFPTTMRLLRIELPDTVSQAQLPALQPGWSAQPELTRTLGNRF
LDDGSALLLPVPSAIMPSTTNYLFNPRHPQAQSAKIQVEDFTPDSRLF
Download Length: 387 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16984.51 Da Isoelectric Point: 5.7258
>AT249350 WP_014591577.1 NZ_CP099727:c5393987-5393538 [Pseudomonas putida]
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEVGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
MLAEVLRDNGYHEYRARLQALLDIPELASDFEIHTRITDGFAATWLVKLTERGVLTPVERDQIIPLRTLKSRIERDQPLT
VDESDRLFRSAHITAMAEAVFGEVGKAKRWLSKPKERFSGLTPMQMLTTQQGTTQVEEMLLQIAEGYGL
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|