249349

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3826716..3827372 Replicon chromosome
Accession NZ_CP099727
Organism Pseudomonas putida strain PCL1760

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NH673_RS16990 Protein ID WP_024718231.1
Coordinates 3827190..3827372 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NH673_RS16985 Protein ID WP_053867847.1
Coordinates 3826716..3827141 (-) Length 142 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH673_RS16945 (NH673_16945) 3822296..3823075 + 780 WP_053867839.1 hypothetical protein -
NH673_RS16950 (NH673_16950) 3823072..3823833 + 762 WP_053867840.1 replication protein P -
NH673_RS16955 (NH673_16955) 3823830..3824045 + 216 WP_053867841.1 hypothetical protein -
NH673_RS16960 (NH673_16960) 3824038..3824508 + 471 WP_053867842.1 hypothetical protein -
NH673_RS16965 (NH673_16965) 3824505..3824795 + 291 WP_053867843.1 hypothetical protein -
NH673_RS16970 (NH673_16970) 3824786..3825388 + 603 WP_053867844.1 recombination protein NinG -
NH673_RS16975 (NH673_16975) 3825385..3825531 + 147 WP_172830916.1 hypothetical protein -
NH673_RS16980 (NH673_16980) 3825528..3826208 + 681 WP_053867845.1 hypothetical protein -
NH673_RS16985 (NH673_16985) 3826716..3827141 - 426 WP_053867847.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NH673_RS16990 (NH673_16990) 3827190..3827372 - 183 WP_024718231.1 type II toxin-antitoxin system HicA family toxin Toxin
NH673_RS16995 (NH673_16995) 3827469..3827780 + 312 WP_053867848.1 hypothetical protein -
NH673_RS17000 (NH673_17000) 3827780..3828049 + 270 WP_012053005.1 hypothetical protein -
NH673_RS17005 (NH673_17005) 3828154..3828615 + 462 WP_230855380.1 lysozyme inhibitor LprI family protein -
NH673_RS17010 (NH673_17010) 3828676..3828867 + 192 WP_053867850.1 hypothetical protein -
NH673_RS17015 (NH673_17015) 3828864..3829112 + 249 WP_053867851.1 hypothetical protein -
NH673_RS17020 (NH673_17020) 3829144..3829347 - 204 WP_053867852.1 hypothetical protein -
NH673_RS17025 (NH673_17025) 3829752..3830360 + 609 WP_053867853.1 putative metallopeptidase -
NH673_RS17030 (NH673_17030) 3830392..3830868 + 477 WP_053867854.1 DUF2280 domain-containing protein -
NH673_RS17035 (NH673_17035) 3830843..3832171 + 1329 WP_053867855.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3799285..3866357 67072


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-66)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 7042.10 Da        Isoelectric Point: 10.6600

>T249349 WP_024718231.1 NZ_CP099727:c3827372-3827190 [Pseudomonas putida]
MKYSEFRRWLEAQGVEFSKSANGSHFKIRYKDRQTIFPSHGSKEIGEGLRKEIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 142 a.a.        Molecular weight: 15222.30 Da        Isoelectric Point: 4.7662

>AT249349 WP_053867847.1 NZ_CP099727:c3827141-3826716 [Pseudomonas putida]
MYDYKIVAHEENDHFWSSCPDIPEAHSVGDSLEELLANAVDGLTLALSIYVDQKRGIPPATEAGDHIVRLSGVTVAKIAL
WNELVRSGKTRADLASMLGISPTAAGRLVDFEHTSKLESLEEALAKFGVRLQVIPTALQAA

Download         Length: 426 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References