Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 181242..181885 | Replicon | plasmid pGDE043-2 |
Accession | NZ_CP099723 | ||
Organism | Escherichia coli strain EC21GDE043 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | NH569_RS26520 | Protein ID | WP_001034044.1 |
Coordinates | 181469..181885 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | NH569_RS26515 | Protein ID | WP_001261286.1 |
Coordinates | 181242..181472 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH569_RS26500 (176379) | 176379..176609 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NH569_RS26505 (176606) | 176606..177022 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
NH569_RS26510 (177067) | 177067..180861 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
NH569_RS26515 (181242) | 181242..181472 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NH569_RS26520 (181469) | 181469..181885 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NH569_RS26525 (181960) | 181960..183525 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
NH569_RS26530 (183510) | 183510..184532 | + | 1023 | WP_032174242.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrS1 / blaLAP-2 / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..203860 | 203860 | |
- | flank | IS/Tn | - | - | 184786..185289 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T249346 WP_001034044.1 NZ_CP099723:181469-181885 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |