Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 176379..177022 Replicon plasmid pGDE043-2
Accession NZ_CP099723
Organism Escherichia coli strain EC21GDE043

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag NH569_RS26505 Protein ID WP_001034046.1
Coordinates 176606..177022 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag NH569_RS26500 Protein ID WP_001261278.1
Coordinates 176379..176609 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH569_RS26470 (172121) 172121..172894 - 774 WP_000905949.1 hypothetical protein -
NH569_RS26475 (172907) 172907..173377 - 471 WP_253031774.1 HEPN family nuclease -
NH569_RS26480 (173354) 173354..174031 + 678 WP_001682408.1 IS66-like element accessory protein TnpA -
NH569_RS26485 (174031) 174031..174378 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
NH569_RS26490 (174398) 174398..175969 + 1572 WP_000381395.1 IS66-like element ISCro1 family transposase -
NH569_RS26495 (176001) 176001..176114 - 114 Protein_192 HEPN family nuclease -
NH569_RS26500 (176379) 176379..176609 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NH569_RS26505 (176606) 176606..177022 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
NH569_RS26510 (177067) 177067..180861 - 3795 WP_001144732.1 hypothetical protein -
NH569_RS26515 (181242) 181242..181472 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NH569_RS26520 (181469) 181469..181885 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrS1 / blaLAP-2 / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..203860 203860


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T249345 WP_001034046.1 NZ_CP099723:176606-177022 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT249345 WP_001261278.1 NZ_CP099723:176379-176609 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References