249344

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 169184..169709 Replicon plasmid pGDE043-2
Accession NZ_CP099723
Organism Escherichia coli strain EC21GDE043

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NH569_RS26450 Protein ID WP_001159871.1
Coordinates 169184..169489 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NH569_RS26455 Protein ID WP_000813630.1
Coordinates 169491..169709 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH569_RS26435 (165140) 165140..166345 - 1206 WP_001442122.1 AAA family ATPase -
NH569_RS26440 (166966) 166966..167697 + 732 WP_000504262.1 replication initiation protein -
NH569_RS26445 (168377) 168377..169183 - 807 WP_000016968.1 site-specific integrase -
NH569_RS26450 (169184) 169184..169489 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NH569_RS26455 (169491) 169491..169709 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NH569_RS26460 (170299) 170299..170787 + 489 WP_011254646.1 hypothetical protein -
NH569_RS26465 (170821) 170821..171954 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
NH569_RS26470 (172121) 172121..172894 - 774 WP_000905949.1 hypothetical protein -
NH569_RS26475 (172907) 172907..173377 - 471 WP_253031774.1 HEPN family nuclease -
NH569_RS26480 (173354) 173354..174031 + 678 WP_001682408.1 IS66-like element accessory protein TnpA -
NH569_RS26485 (174031) 174031..174378 + 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrS1 / blaLAP-2 / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..203860 203860


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T249344 WP_001159871.1 NZ_CP099723:c169489-169184 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT249344 WP_000813630.1 NZ_CP099723:c169709-169491 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References