Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 124844..125469 | Replicon | plasmid pGDE043-2 |
Accession | NZ_CP099723 | ||
Organism | Escherichia coli strain EC21GDE043 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NH569_RS26185 | Protein ID | WP_000911333.1 |
Coordinates | 125071..125469 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | NH569_RS26180 | Protein ID | WP_000450520.1 |
Coordinates | 124844..125071 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH569_RS26180 (124844) | 124844..125071 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NH569_RS26185 (125071) | 125071..125469 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NH569_RS26190 (125478) | 125478..127631 | - | 2154 | WP_000009379.1 | type IV conjugative transfer system coupling protein TraD | - |
NH569_RS26195 (127884) | 127884..128594 | - | 711 | WP_231793510.1 | conjugal transfer complement resistance protein TraT | - |
NH569_RS26200 (128629) | 128629..129138 | - | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | qnrS1 / blaLAP-2 / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..203860 | 203860 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T249340 WP_000911333.1 NZ_CP099723:125071-125469 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|