Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3521696..3522314 | Replicon | chromosome |
Accession | NZ_CP099721 | ||
Organism | Escherichia coli strain EC21GDE043 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NH569_RS17240 | Protein ID | WP_001291435.1 |
Coordinates | 3522096..3522314 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NH569_RS17235 | Protein ID | WP_000344800.1 |
Coordinates | 3521696..3522070 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH569_RS17225 (3516786) | 3516786..3517979 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NH569_RS17230 (3518002) | 3518002..3521151 | + | 3150 | WP_001132463.1 | efflux RND transporter permease AcrB | - |
NH569_RS17235 (3521696) | 3521696..3522070 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NH569_RS17240 (3522096) | 3522096..3522314 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NH569_RS17245 (3522488) | 3522488..3523039 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
NH569_RS17250 (3523155) | 3523155..3523625 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NH569_RS17255 (3523789) | 3523789..3525339 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NH569_RS17260 (3525381) | 3525381..3525734 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NH569_RS17270 (3526113) | 3526113..3526424 | + | 312 | WP_000409908.1 | MGMT family protein | - |
NH569_RS17275 (3526455) | 3526455..3527027 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T249328 WP_001291435.1 NZ_CP099721:3522096-3522314 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT249328 WP_000344800.1 NZ_CP099721:3521696-3522070 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |