Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1938924..1939755 Replicon chromosome
Accession NZ_CP099721
Organism Escherichia coli strain EC21GDE043

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NH569_RS09250 Protein ID WP_000854814.1
Coordinates 1938924..1939298 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID P76364
Locus tag NH569_RS09255 Protein ID WP_001285584.1
Coordinates 1939387..1939755 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH569_RS09210 (1934320) 1934320..1935486 + 1167 WP_001513842.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NH569_RS09215 (1935605) 1935605..1936078 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
NH569_RS09220 (1936276) 1936276..1937334 + 1059 WP_001200888.1 FUSC family protein -
NH569_RS09225 (1937506) 1937506..1937835 + 330 WP_000450409.1 DUF496 family protein -
NH569_RS09230 (1937936) 1937936..1938070 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
NH569_RS09235 (1938190) 1938190..1938318 + 129 Protein_1810 transposase domain-containing protein -
NH569_RS09240 (1938607) 1938607..1938687 - 81 Protein_1811 hypothetical protein -
NH569_RS09245 (1938733) 1938733..1938927 - 195 WP_000988600.1 DUF5983 family protein -
NH569_RS09250 (1938924) 1938924..1939298 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NH569_RS09255 (1939387) 1939387..1939755 - 369 WP_001285584.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NH569_RS09260 (1939829) 1939829..1940050 - 222 WP_000692323.1 DUF987 domain-containing protein -
NH569_RS09265 (1940113) 1940113..1940589 - 477 WP_001186773.1 RadC family protein -
NH569_RS09270 (1940605) 1940605..1941084 - 480 WP_000860076.1 antirestriction protein -
NH569_RS09275 (1941166) 1941166..1941984 - 819 WP_001234629.1 DUF932 domain-containing protein -
NH569_RS09280 (1942084) 1942084..1942317 - 234 WP_001119729.1 DUF905 family protein -
NH569_RS09285 (1942396) 1942396..1942851 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T249320 WP_000854814.1 NZ_CP099721:c1939298-1938924 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.9541

>AT249320 WP_001285584.1 NZ_CP099721:c1939755-1939387 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
PDB 2H28
AlphaFold DB A0A1M2E8G6

References