Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 867171..868006 Replicon chromosome
Accession NZ_CP099721
Organism Escherichia coli strain EC21GDE043

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1C0Y405
Locus tag NH569_RS04210 Protein ID WP_001774607.1
Coordinates 867171..867548 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M2U6P5
Locus tag NH569_RS04215 Protein ID WP_001774606.1
Coordinates 867638..868006 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NH569_RS04185 (863245) 863245..864228 - 984 WP_001331698.1 KpsF/GutQ family sugar-phosphate isomerase -
NH569_RS04190 (865038) 865038..865208 - 171 Protein_824 IS110 family transposase -
NH569_RS04195 (865550) 865550..866392 - 843 WP_032152755.1 DUF4942 domain-containing protein -
NH569_RS04200 (866477) 866477..866674 - 198 WP_032152719.1 DUF957 domain-containing protein -
NH569_RS04205 (866686) 866686..867174 - 489 WP_001774608.1 DUF5983 family protein -
NH569_RS04210 (867171) 867171..867548 - 378 WP_001774607.1 TA system toxin CbtA family protein Toxin
NH569_RS04215 (867638) 867638..868006 - 369 WP_001774606.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NH569_RS04220 (868056) 868056..868700 - 645 WP_001774605.1 hypothetical protein -
NH569_RS04225 (868719) 868719..868940 - 222 WP_000692312.1 DUF987 domain-containing protein -
NH569_RS04230 (869003) 869003..869479 - 477 WP_001297237.1 RadC family protein -
NH569_RS04235 (869495) 869495..869974 - 480 WP_032152717.1 antirestriction protein -
NH569_RS04240 (870068) 870068..870313 - 246 WP_016238868.1 hypothetical protein -
NH569_RS04245 (870313) 870313..871131 - 819 WP_016238867.1 DUF932 domain-containing protein -
NH569_RS04250 (871230) 871230..871463 - 234 WP_001278287.1 DUF905 family protein -
NH569_RS04255 (871469) 871469..872146 - 678 WP_001097305.1 hypothetical protein -
NH569_RS04260 (872294) 872294..872974 - 681 WP_032082725.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 865038..865142 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14218.20 Da        Isoelectric Point: 7.8045

>T249316 WP_001774607.1 NZ_CP099721:c867548-867171 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.31 Da        Isoelectric Point: 5.8746

>AT249316 WP_001774606.1 NZ_CP099721:c868006-867638 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C0Y405

Antitoxin

Source ID Structure
AlphaFold DB A0A1M2U6P5

References