Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 867171..868006 | Replicon | chromosome |
| Accession | NZ_CP099721 | ||
| Organism | Escherichia coli strain EC21GDE043 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1C0Y405 |
| Locus tag | NH569_RS04210 | Protein ID | WP_001774607.1 |
| Coordinates | 867171..867548 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M2U6P5 |
| Locus tag | NH569_RS04215 | Protein ID | WP_001774606.1 |
| Coordinates | 867638..868006 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH569_RS04185 (863245) | 863245..864228 | - | 984 | WP_001331698.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| NH569_RS04190 (865038) | 865038..865208 | - | 171 | Protein_824 | IS110 family transposase | - |
| NH569_RS04195 (865550) | 865550..866392 | - | 843 | WP_032152755.1 | DUF4942 domain-containing protein | - |
| NH569_RS04200 (866477) | 866477..866674 | - | 198 | WP_032152719.1 | DUF957 domain-containing protein | - |
| NH569_RS04205 (866686) | 866686..867174 | - | 489 | WP_001774608.1 | DUF5983 family protein | - |
| NH569_RS04210 (867171) | 867171..867548 | - | 378 | WP_001774607.1 | TA system toxin CbtA family protein | Toxin |
| NH569_RS04215 (867638) | 867638..868006 | - | 369 | WP_001774606.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NH569_RS04220 (868056) | 868056..868700 | - | 645 | WP_001774605.1 | hypothetical protein | - |
| NH569_RS04225 (868719) | 868719..868940 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| NH569_RS04230 (869003) | 869003..869479 | - | 477 | WP_001297237.1 | RadC family protein | - |
| NH569_RS04235 (869495) | 869495..869974 | - | 480 | WP_032152717.1 | antirestriction protein | - |
| NH569_RS04240 (870068) | 870068..870313 | - | 246 | WP_016238868.1 | hypothetical protein | - |
| NH569_RS04245 (870313) | 870313..871131 | - | 819 | WP_016238867.1 | DUF932 domain-containing protein | - |
| NH569_RS04250 (871230) | 871230..871463 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| NH569_RS04255 (871469) | 871469..872146 | - | 678 | WP_001097305.1 | hypothetical protein | - |
| NH569_RS04260 (872294) | 872294..872974 | - | 681 | WP_032082725.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 865038..865142 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14218.20 Da Isoelectric Point: 7.8045
>T249316 WP_001774607.1 NZ_CP099721:c867548-867171 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.31 Da Isoelectric Point: 5.8746
>AT249316 WP_001774606.1 NZ_CP099721:c868006-867638 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C0Y405 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2U6P5 |