Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 707362..708194 | Replicon | chromosome |
Accession | NZ_CP099721 | ||
Organism | Escherichia coli strain EC21GDE043 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | F4TJC5 |
Locus tag | NH569_RS03460 | Protein ID | WP_001094452.1 |
Coordinates | 707820..708194 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | F4TJC4 |
Locus tag | NH569_RS03455 | Protein ID | WP_001285579.1 |
Coordinates | 707362..707730 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NH569_RS03435 (705111) | 705111..705929 | + | 819 | WP_001564116.1 | DUF932 domain-containing protein | - |
NH569_RS03440 (706021) | 706021..706506 | + | 486 | WP_000206669.1 | antirestriction protein | - |
NH569_RS03445 (706522) | 706522..706998 | + | 477 | WP_001186706.1 | RadC family protein | - |
NH569_RS03450 (707061) | 707061..707282 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
NH569_RS03455 (707362) | 707362..707730 | + | 369 | WP_001285579.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NH569_RS03460 (707820) | 707820..708194 | + | 375 | WP_001094452.1 | TA system toxin CbtA family protein | Toxin |
NH569_RS03465 (708191) | 708191..708682 | + | 492 | WP_000976868.1 | DUF5983 family protein | - |
NH569_RS03470 (708694) | 708694..708891 | + | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
NH569_RS03475 (708988) | 708988..709833 | + | 846 | WP_021539310.1 | DUF4942 domain-containing protein | - |
NH569_RS03485 (710133) | 710133..710639 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
NH569_RS03490 (710718) | 710718..712559 | - | 1842 | WP_000437380.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14014.86 Da Isoelectric Point: 7.2920
>T249315 WP_001094452.1 NZ_CP099721:707820-708194 [Escherichia coli]
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MNTLPDTHVREASRCSSPVTIWQTLLTRLLDQHYGLTLNDTPFSDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSTDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z7YIM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z8DWX2 |