Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-YefM
Location 14006..14522 Replicon plasmid pDK313-58
Accession NZ_CP099713
Organism Dietzia kunjamensis strain 313

Toxin (Protein)


Gene name relB Uniprot ID A0A166Q8Z2
Locus tag NHB83_RS17505 Protein ID WP_061228632.1
Coordinates 14006..14263 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag NHB83_RS17510 Protein ID WP_253003879.1
Coordinates 14265..14522 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHB83_RS17480 (NHB83_17480) 10863..11495 - 633 WP_245847723.1 tyrosine-type recombinase/integrase -
NHB83_RS17485 (NHB83_17485) 11753..11950 - 198 Protein_13 site-specific integrase -
NHB83_RS17490 (NHB83_17490) 12034..12732 - 699 WP_259848149.1 IS3 family transposase -
NHB83_RS17495 (NHB83_17495) 13176..13541 + 366 WP_253003877.1 hypothetical protein -
NHB83_RS17500 (NHB83_17500) 13538..13876 - 339 WP_253003878.1 Lsr2 family protein -
NHB83_RS17505 (NHB83_17505) 14006..14263 - 258 WP_061228632.1 Txe/YoeB family addiction module toxin Toxin
NHB83_RS17510 (NHB83_17510) 14265..14522 - 258 WP_253003879.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
NHB83_RS17515 (NHB83_17515) 14884..15264 + 381 WP_253003880.1 hypothetical protein -
NHB83_RS17520 (NHB83_17520) 15486..16130 + 645 WP_253003881.1 hypothetical protein -
NHB83_RS17525 (NHB83_17525) 16332..16901 + 570 WP_132064331.1 DNA-binding protein -
NHB83_RS19165 16964..17122 - 159 WP_259825220.1 type II toxin-antitoxin system YoeB family toxin -
NHB83_RS17530 (NHB83_17530) 17348..17875 + 528 WP_227022468.1 Asp23/Gls24 family envelope stress response protein -
NHB83_RS17535 (NHB83_17535) 17957..18133 + 177 WP_253003882.1 hypothetical protein -
NHB83_RS17540 (NHB83_17540) 18137..18562 + 426 WP_253003883.1 Asp23/Gls24 family envelope stress response protein -
NHB83_RS17545 (NHB83_17545) 18559..19113 + 555 WP_253003884.1 DUF6286 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..58638 58638


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-73)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10355.73 Da        Isoelectric Point: 8.0063

>T249308 WP_061228632.1 NZ_CP099713:c14263-14006 [Dietzia kunjamensis]
VLLVWDDNAWQDYLWWQQQDRKILKRINLLLQDITRNGNEGIGKPEPLKYDFAGYWSRRITDEHRLVYKVTDTEVRIATC
RYHYG

Download         Length: 258 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9666.83 Da        Isoelectric Point: 4.6899

>AT249308 WP_253003879.1 NZ_CP099713:c14522-14265 [Dietzia kunjamensis]
MKTMSYTESRARYAEVLDGVTNDREEVIITRAGHEPVVMVSLDDYESLRETAHLMRSPANARRLLDAMERLETGRGQARD
LLDAD

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A166Q8Z2

Antitoxin

Source ID Structure

References