Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 72857..73452 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP099648 | ||
| Organism | Paraburkholderia fungorum strain OTU2SAUBB1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NHH62_RS41090 | Protein ID | WP_253045751.1 |
| Coordinates | 73162..73452 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NHH62_RS41085 | Protein ID | WP_253045749.1 |
| Coordinates | 72857..73165 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHH62_RS41060 (NHH62_41060) | 68819..69499 | - | 681 | WP_253045740.1 | hypothetical protein | - |
| NHH62_RS41065 (NHH62_41065) | 69677..70648 | - | 972 | WP_253045742.1 | tyrosine-type recombinase/integrase | - |
| NHH62_RS41070 (NHH62_41070) | 70666..70857 | - | 192 | WP_253045743.1 | hypothetical protein | - |
| NHH62_RS41075 (NHH62_41075) | 71115..72008 | + | 894 | WP_253045745.1 | DNA-binding protein | - |
| NHH62_RS41080 (NHH62_41080) | 72039..72758 | + | 720 | WP_253045747.1 | hypothetical protein | - |
| NHH62_RS41085 (NHH62_41085) | 72857..73165 | + | 309 | WP_253045749.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NHH62_RS41090 (NHH62_41090) | 73162..73452 | + | 291 | WP_253045751.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NHH62_RS41095 (NHH62_41095) | 73476..74183 | + | 708 | WP_253045753.1 | ATP-binding protein | - |
| NHH62_RS41100 (NHH62_41100) | 74231..74743 | + | 513 | WP_253045755.1 | hypothetical protein | - |
| NHH62_RS41105 (NHH62_41105) | 74769..76085 | + | 1317 | WP_253045757.1 | IS701 family transposase | - |
| NHH62_RS41110 (NHH62_41110) | 76765..77322 | + | 558 | WP_046565095.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..83927 | 83927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11176.70 Da Isoelectric Point: 4.8838
>T249287 WP_253045751.1 NZ_CP099648:73162-73452 [Paraburkholderia fungorum]
VRLEWSAFAIEDRDAIFDYIEEDRPRAAVVVDDRIRTQVRQLLQFPETGRPGRIEGTRELVISRTPYIAAYRITGDTVRI
LRVLHGAQLWPDEILD
VRLEWSAFAIEDRDAIFDYIEEDRPRAAVVVDDRIRTQVRQLLQFPETGRPGRIEGTRELVISRTPYIAAYRITGDTVRI
LRVLHGAQLWPDEILD
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|