Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4597417..4598006 | Replicon | chromosome |
| Accession | NZ_CP099647 | ||
| Organism | Paraburkholderia fungorum strain OTU2SAUBB1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NHH62_RS39945 | Protein ID | WP_030102377.1 |
| Coordinates | 4597417..4597599 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0D5V779 |
| Locus tag | NHH62_RS39950 | Protein ID | WP_028198501.1 |
| Coordinates | 4597596..4598006 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHH62_RS39915 (NHH62_39915) | 4592502..4593191 | - | 690 | WP_235429695.1 | flagellar hook assembly protein FlgD | - |
| NHH62_RS39920 (NHH62_39920) | 4593259..4593684 | - | 426 | WP_028198507.1 | flagellar basal body rod protein FlgC | - |
| NHH62_RS39925 (NHH62_39925) | 4593855..4594349 | - | 495 | WP_028198506.1 | flagellar basal body rod protein FlgB | - |
| NHH62_RS39930 (NHH62_39930) | 4594567..4596027 | + | 1461 | WP_030102376.1 | flagellar basal body P-ring formation chaperone FlgA | - |
| NHH62_RS39935 (NHH62_39935) | 4596211..4596567 | + | 357 | WP_028198504.1 | flagellar biosynthesis anti-sigma factor FlgM | - |
| NHH62_RS39940 (NHH62_39940) | 4596662..4597108 | + | 447 | WP_028198503.1 | flagellar protein FlgN | - |
| NHH62_RS39945 (NHH62_39945) | 4597417..4597599 | + | 183 | WP_030102377.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NHH62_RS39950 (NHH62_39950) | 4597596..4598006 | + | 411 | WP_028198501.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NHH62_RS39955 (NHH62_39955) | 4598071..4598811 | - | 741 | WP_028198500.1 | RNA polymerase sigma factor FliA | - |
| NHH62_RS39960 (NHH62_39960) | 4598840..4599709 | - | 870 | WP_030102378.1 | P-loop NTPase | - |
| NHH62_RS39965 (NHH62_39965) | 4599702..4601633 | - | 1932 | WP_030102379.1 | flagellar biosynthesis protein FlhF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6486.66 Da Isoelectric Point: 11.0676
>T249286 WP_030102377.1 NZ_CP099647:4597417-4597599 [Paraburkholderia fungorum]
MNSAEVVKVIQADGCRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK
MNSAEVVKVIQADGCRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14824.81 Da Isoelectric Point: 4.9474
>AT249286 WP_028198501.1 NZ_CP099647:4597596-4598006 [Paraburkholderia fungorum]
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|