Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpA-AbkA/BrnT_toxin-BrnA |
| Location | 4543262..4543867 | Replicon | chromosome |
| Accession | NZ_CP099647 | ||
| Organism | Paraburkholderia fungorum strain OTU2SAUBB1 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NHH62_RS39695 | Protein ID | WP_081923075.1 |
| Coordinates | 4543562..4543867 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | AbkA | Uniprot ID | A0A2T1ARB7 |
| Locus tag | NHH62_RS39690 | Protein ID | WP_030102352.1 |
| Coordinates | 4543262..4543519 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHH62_RS39670 (NHH62_39670) | 4538518..4539270 | + | 753 | WP_030102350.1 | 5-oxoprolinase subunit PxpA | - |
| NHH62_RS39675 (NHH62_39675) | 4539544..4540293 | + | 750 | WP_028198554.1 | DUF969 domain-containing protein | - |
| NHH62_RS39680 (NHH62_39680) | 4540290..4541246 | + | 957 | WP_028198553.1 | DUF979 domain-containing protein | - |
| NHH62_RS39685 (NHH62_39685) | 4541460..4543265 | + | 1806 | WP_030102351.1 | tetratricopeptide repeat protein | - |
| NHH62_RS39690 (NHH62_39690) | 4543262..4543519 | - | 258 | WP_030102352.1 | BrnA antitoxin family protein | Antitoxin |
| NHH62_RS39695 (NHH62_39695) | 4543562..4543867 | - | 306 | WP_081923075.1 | BrnT family toxin | Toxin |
| NHH62_RS39700 (NHH62_39700) | 4544048..4545199 | - | 1152 | WP_030102354.1 | TraB/GumN family protein | - |
| NHH62_RS39705 (NHH62_39705) | 4545192..4546211 | - | 1020 | WP_028198550.1 | peptide ABC transporter ATP-binding protein | - |
| NHH62_RS39710 (NHH62_39710) | 4546208..4547212 | - | 1005 | WP_030102356.1 | ABC transporter ATP-binding protein | - |
| NHH62_RS39715 (NHH62_39715) | 4547214..4548131 | - | 918 | WP_028198548.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12095.90 Da Isoelectric Point: 10.2615
>T249285 WP_081923075.1 NZ_CP099647:c4543867-4543562 [Paraburkholderia fungorum]
MYKRKYGWRVRFEWDEVKNQINIRTHGIDFRDAVNVFDHPVLTAMDQRQDYGEDRWIALGWMVAIVGVVVYVERSADVVR
IISARKATKHEVKRFKQSVWN
MYKRKYGWRVRFEWDEVKNQINIRTHGIDFRDAVNVFDHPVLTAMDQRQDYGEDRWIALGWMVAIVGVVVYVERSADVVR
IISARKATKHEVKRFKQSVWN
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|