Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 2303881..2304422 | Replicon | chromosome |
| Accession | NZ_CP099647 | ||
| Organism | Paraburkholderia fungorum strain OTU2SAUBB1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | NHH62_RS29405 | Protein ID | WP_028224916.1 |
| Coordinates | 2303881..2304183 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | NHH62_RS29410 | Protein ID | WP_028224915.1 |
| Coordinates | 2304180..2304422 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHH62_RS29380 (NHH62_29390) | 2299755..2300024 | - | 270 | WP_028224920.1 | hypothetical protein | - |
| NHH62_RS29385 (NHH62_29395) | 2300100..2300840 | + | 741 | WP_028224919.1 | VirB8/TrbF family protein | - |
| NHH62_RS29390 (NHH62_29400) | 2301032..2301883 | + | 852 | WP_253045668.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| NHH62_RS29395 (NHH62_29405) | 2301886..2303220 | + | 1335 | WP_048995887.1 | TrbI/VirB10 family protein | - |
| NHH62_RS29400 (NHH62_29410) | 2303217..2303642 | + | 426 | WP_080763853.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| NHH62_RS29405 (NHH62_29415) | 2303881..2304183 | - | 303 | WP_028224916.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NHH62_RS29410 (NHH62_29420) | 2304180..2304422 | - | 243 | WP_028224915.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| NHH62_RS29415 (NHH62_29425) | 2304705..2305124 | - | 420 | WP_028224914.1 | ACT domain-containing protein | - |
| NHH62_RS29420 (NHH62_29430) | 2305302..2305526 | + | 225 | WP_028224913.1 | helix-turn-helix transcriptional regulator | - |
| NHH62_RS29425 (NHH62_29435) | 2305931..2306593 | + | 663 | WP_105780487.1 | DUF3577 domain-containing protein | - |
| NHH62_RS29430 (NHH62_29440) | 2307143..2307610 | + | 468 | WP_146123808.1 | hypothetical protein | - |
| NHH62_RS29435 (NHH62_29445) | 2307689..2308522 | + | 834 | WP_048995892.1 | hypothetical protein | - |
| NHH62_RS29440 (NHH62_29450) | 2308555..2309310 | + | 756 | WP_253045669.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2233670..2423830 | 190160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11308.77 Da Isoelectric Point: 4.5010
>T249283 WP_028224916.1 NZ_CP099647:c2304183-2303881 [Paraburkholderia fungorum]
MKAFVLSPAAERDLDDIWDYTVTRWGEVQAERYILSIESTIAGLADGTQPSLSAADVRDGYRKALTGMHVVFFRESEALI
DVIRILHQQMDIPRRLGDDN
MKAFVLSPAAERDLDDIWDYTVTRWGEVQAERYILSIESTIAGLADGTQPSLSAADVRDGYRKALTGMHVVFFRESEALI
DVIRILHQQMDIPRRLGDDN
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|