Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2303881..2304422 Replicon chromosome
Accession NZ_CP099647
Organism Paraburkholderia fungorum strain OTU2SAUBB1

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NHH62_RS29405 Protein ID WP_028224916.1
Coordinates 2303881..2304183 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag NHH62_RS29410 Protein ID WP_028224915.1
Coordinates 2304180..2304422 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHH62_RS29380 (NHH62_29390) 2299755..2300024 - 270 WP_028224920.1 hypothetical protein -
NHH62_RS29385 (NHH62_29395) 2300100..2300840 + 741 WP_028224919.1 VirB8/TrbF family protein -
NHH62_RS29390 (NHH62_29400) 2301032..2301883 + 852 WP_253045668.1 TrbG/VirB9 family P-type conjugative transfer protein -
NHH62_RS29395 (NHH62_29405) 2301886..2303220 + 1335 WP_048995887.1 TrbI/VirB10 family protein -
NHH62_RS29400 (NHH62_29410) 2303217..2303642 + 426 WP_080763853.1 TrbG/VirB9 family P-type conjugative transfer protein -
NHH62_RS29405 (NHH62_29415) 2303881..2304183 - 303 WP_028224916.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NHH62_RS29410 (NHH62_29420) 2304180..2304422 - 243 WP_028224915.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
NHH62_RS29415 (NHH62_29425) 2304705..2305124 - 420 WP_028224914.1 ACT domain-containing protein -
NHH62_RS29420 (NHH62_29430) 2305302..2305526 + 225 WP_028224913.1 helix-turn-helix transcriptional regulator -
NHH62_RS29425 (NHH62_29435) 2305931..2306593 + 663 WP_105780487.1 DUF3577 domain-containing protein -
NHH62_RS29430 (NHH62_29440) 2307143..2307610 + 468 WP_146123808.1 hypothetical protein -
NHH62_RS29435 (NHH62_29445) 2307689..2308522 + 834 WP_048995892.1 hypothetical protein -
NHH62_RS29440 (NHH62_29450) 2308555..2309310 + 756 WP_253045669.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2233670..2423830 190160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-91)

Antitoxin

Antitoxin ParD

(1-77)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11308.77 Da        Isoelectric Point: 4.5010

>T249283 WP_028224916.1 NZ_CP099647:c2304183-2303881 [Paraburkholderia fungorum]
MKAFVLSPAAERDLDDIWDYTVTRWGEVQAERYILSIESTIAGLADGTQPSLSAADVRDGYRKALTGMHVVFFRESEALI
DVIRILHQQMDIPRRLGDDN

Download         Length: 303 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8968.00 Da        Isoelectric Point: 9.8256

>AT249283 WP_028224915.1 NZ_CP099647:c2304422-2304180 [Paraburkholderia fungorum]
MSKSTSFTLGEHFSEFVDDRVRSGRYSTASDVVRAGLRLLETEEARLEALRSALIEGEQSGPSRPFDFRKYVAGKRNRAA

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References