Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2159223..2159825 | Replicon | chromosome |
Accession | NZ_CP099645 | ||
Organism | Paraburkholderia fungorum strain OTU2SAUBB1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A2N8Q3W2 |
Locus tag | NHH62_RS11865 | Protein ID | WP_028194450.1 |
Coordinates | 2159223..2159522 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A0D5VNN5 |
Locus tag | NHH62_RS11870 | Protein ID | WP_028194449.1 |
Coordinates | 2159526..2159825 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHH62_RS11850 (NHH62_11855) | 2155514..2156467 | - | 954 | WP_235430069.1 | choline ABC transporter substrate-binding protein | - |
NHH62_RS11855 (NHH62_11860) | 2156530..2158077 | - | 1548 | WP_030100588.1 | choline-sulfatase | - |
NHH62_RS11860 (NHH62_11865) | 2158230..2159144 | + | 915 | WP_030100589.1 | LysR family transcriptional regulator | - |
NHH62_RS11865 (NHH62_11870) | 2159223..2159522 | + | 300 | WP_028194450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHH62_RS11870 (NHH62_11875) | 2159526..2159825 | + | 300 | WP_028194449.1 | putative addiction module antidote protein | Antitoxin |
NHH62_RS11875 (NHH62_11880) | 2159997..2160872 | + | 876 | WP_030100590.1 | formyltetrahydrofolate deformylase | - |
NHH62_RS11880 (NHH62_11885) | 2160967..2161824 | - | 858 | WP_028194447.1 | glycine betaine ABC transporter substrate-binding protein | - |
NHH62_RS11885 (NHH62_11890) | 2161968..2163224 | - | 1257 | WP_096335844.1 | hybrid-cluster NAD(P)-dependent oxidoreductase | - |
NHH62_RS11890 (NHH62_11895) | 2163261..2164571 | - | 1311 | WP_030100592.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2158272..2163224 | 4952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11009.69 Da Isoelectric Point: 9.6247
>T249281 WP_028194450.1 NZ_CP099645:2159223-2159522 [Paraburkholderia fungorum]
MLKIRTTETFDAWFDGLKDRIARRRIQARIDRLAMGNPGDTNSAGAPIIELRIDHGPGYRVYYVQRGAVLVILLCGGDKS
TQPADIKAAHKMLANLESE
MLKIRTTETFDAWFDGLKDRIARRRIQARIDRLAMGNPGDTNSAGAPIIELRIDHGPGYRVYYVQRGAVLVILLCGGDKS
TQPADIKAAHKMLANLESE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N8Q3W2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D5VNN5 |