Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3502366..3502968 | Replicon | chromosome |
| Accession | NZ_CP099629 | ||
| Organism | Paraburkholderia fungorum strain OTU2BAGNBA2 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A2N8Q3W2 |
| Locus tag | NFS19_RS38360 | Protein ID | WP_028194450.1 |
| Coordinates | 3502366..3502665 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A0D5VNN5 |
| Locus tag | NFS19_RS38365 | Protein ID | WP_028194449.1 |
| Coordinates | 3502669..3502968 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFS19_RS38345 (NFS19_38335) | 3498668..3499621 | - | 954 | WP_235430069.1 | choline ABC transporter substrate-binding protein | - |
| NFS19_RS38350 (NFS19_38340) | 3499673..3501220 | - | 1548 | WP_252890181.1 | choline-sulfatase | - |
| NFS19_RS38355 (NFS19_38345) | 3501373..3502287 | + | 915 | WP_178370025.1 | LysR family transcriptional regulator | - |
| NFS19_RS38360 (NFS19_38350) | 3502366..3502665 | + | 300 | WP_028194450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFS19_RS38365 (NFS19_38355) | 3502669..3502968 | + | 300 | WP_028194449.1 | putative addiction module antidote protein | Antitoxin |
| NFS19_RS38370 (NFS19_38360) | 3503140..3504015 | + | 876 | WP_252890180.1 | formyltetrahydrofolate deformylase | - |
| NFS19_RS38375 (NFS19_38365) | 3504110..3504967 | - | 858 | WP_028194447.1 | glycine betaine ABC transporter substrate-binding protein | - |
| NFS19_RS38380 (NFS19_38370) | 3505110..3506366 | - | 1257 | WP_102857553.1 | hybrid-cluster NAD(P)-dependent oxidoreductase | - |
| NFS19_RS38385 (NFS19_38375) | 3506403..3507713 | - | 1311 | WP_046570534.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3501373..3506366 | 4993 | |
| - | inside | Prophage | - | - | 3501373..3516634 | 15261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11009.69 Da Isoelectric Point: 9.6247
>T249279 WP_028194450.1 NZ_CP099629:3502366-3502665 [Paraburkholderia fungorum]
MLKIRTTETFDAWFDGLKDRIARRRIQARIDRLAMGNPGDTNSAGAPIIELRIDHGPGYRVYYVQRGAVLVILLCGGDKS
TQPADIKAAHKMLANLESE
MLKIRTTETFDAWFDGLKDRIARRRIQARIDRLAMGNPGDTNSAGAPIIELRIDHGPGYRVYYVQRGAVLVILLCGGDKS
TQPADIKAAHKMLANLESE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2N8Q3W2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D5VNN5 |