Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4717739..4718328 Replicon chromosome
Accession NZ_CP099627
Organism Paraburkholderia fungorum strain OTU2BAGNBA2

Toxin (Protein)


Gene name hicA Uniprot ID A0A1I7EHY9
Locus tag NFS19_RS21170 Protein ID WP_028198502.1
Coordinates 4717739..4717921 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A0D5V779
Locus tag NFS19_RS21175 Protein ID WP_028198501.1
Coordinates 4717918..4718328 (+) Length 137 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFS19_RS21140 (NFS19_21130) 4712824..4713513 - 690 WP_235429695.1 flagellar hook assembly protein FlgD -
NFS19_RS21145 (NFS19_21135) 4713581..4714006 - 426 WP_028198507.1 flagellar basal body rod protein FlgC -
NFS19_RS21150 (NFS19_21140) 4714177..4714671 - 495 WP_028198506.1 flagellar basal body rod protein FlgB -
NFS19_RS21155 (NFS19_21145) 4714889..4716349 + 1461 WP_252888526.1 flagellar basal body P-ring formation chaperone FlgA -
NFS19_RS21160 (NFS19_21150) 4716533..4716889 + 357 WP_028198504.1 flagellar biosynthesis anti-sigma factor FlgM -
NFS19_RS21165 (NFS19_21155) 4716984..4717430 + 447 WP_028198503.1 flagellar protein FlgN -
NFS19_RS21170 (NFS19_21160) 4717739..4717921 + 183 WP_028198502.1 type II toxin-antitoxin system HicA family toxin Toxin
NFS19_RS21175 (NFS19_21165) 4717918..4718328 + 411 WP_028198501.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NFS19_RS21180 (NFS19_21170) 4718393..4719133 - 741 WP_028198500.1 RNA polymerase sigma factor FliA -
NFS19_RS21185 (NFS19_21175) 4719162..4720031 - 870 WP_028198499.1 P-loop NTPase -
NFS19_RS21190 (NFS19_21180) 4720024..4721955 - 1932 WP_252888527.1 flagellar biosynthesis protein FlhF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(6-129)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6569.73 Da        Isoelectric Point: 11.3940

>T249276 WP_028198502.1 NZ_CP099627:4717739-4717921 [Paraburkholderia fungorum]
MNSAEVVKVIQADGWRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 137 a.a.        Molecular weight: 14824.81 Da        Isoelectric Point: 4.9474

>AT249276 WP_028198501.1 NZ_CP099627:4717918-4718328 [Paraburkholderia fungorum]
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA

Download         Length: 411 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1I7EHY9

Antitoxin

Source ID Structure
AlphaFold DB A0A0D5V779

References