Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4717739..4718328 | Replicon | chromosome |
| Accession | NZ_CP099627 | ||
| Organism | Paraburkholderia fungorum strain OTU2BAGNBA2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1I7EHY9 |
| Locus tag | NFS19_RS21170 | Protein ID | WP_028198502.1 |
| Coordinates | 4717739..4717921 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A0D5V779 |
| Locus tag | NFS19_RS21175 | Protein ID | WP_028198501.1 |
| Coordinates | 4717918..4718328 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFS19_RS21140 (NFS19_21130) | 4712824..4713513 | - | 690 | WP_235429695.1 | flagellar hook assembly protein FlgD | - |
| NFS19_RS21145 (NFS19_21135) | 4713581..4714006 | - | 426 | WP_028198507.1 | flagellar basal body rod protein FlgC | - |
| NFS19_RS21150 (NFS19_21140) | 4714177..4714671 | - | 495 | WP_028198506.1 | flagellar basal body rod protein FlgB | - |
| NFS19_RS21155 (NFS19_21145) | 4714889..4716349 | + | 1461 | WP_252888526.1 | flagellar basal body P-ring formation chaperone FlgA | - |
| NFS19_RS21160 (NFS19_21150) | 4716533..4716889 | + | 357 | WP_028198504.1 | flagellar biosynthesis anti-sigma factor FlgM | - |
| NFS19_RS21165 (NFS19_21155) | 4716984..4717430 | + | 447 | WP_028198503.1 | flagellar protein FlgN | - |
| NFS19_RS21170 (NFS19_21160) | 4717739..4717921 | + | 183 | WP_028198502.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NFS19_RS21175 (NFS19_21165) | 4717918..4718328 | + | 411 | WP_028198501.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NFS19_RS21180 (NFS19_21170) | 4718393..4719133 | - | 741 | WP_028198500.1 | RNA polymerase sigma factor FliA | - |
| NFS19_RS21185 (NFS19_21175) | 4719162..4720031 | - | 870 | WP_028198499.1 | P-loop NTPase | - |
| NFS19_RS21190 (NFS19_21180) | 4720024..4721955 | - | 1932 | WP_252888527.1 | flagellar biosynthesis protein FlhF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6569.73 Da Isoelectric Point: 11.3940
>T249276 WP_028198502.1 NZ_CP099627:4717739-4717921 [Paraburkholderia fungorum]
MNSAEVVKVIQADGWRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK
MNSAEVVKVIQADGWRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14824.81 Da Isoelectric Point: 4.9474
>AT249276 WP_028198501.1 NZ_CP099627:4717918-4718328 [Paraburkholderia fungorum]
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1I7EHY9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D5V779 |