Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 81667..82269 | Replicon | chromosome |
Accession | NZ_CP099625 | ||
Organism | Paraburkholderia fungorum strain OTU2BAGNBA1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A2N8Q3W2 |
Locus tag | NFE55_RS23205 | Protein ID | WP_028194450.1 |
Coordinates | 81970..82269 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A0D5VNN5 |
Locus tag | NFE55_RS23200 | Protein ID | WP_028194449.1 |
Coordinates | 81667..81966 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFE55_RS23180 (NFE55_23180) | 76922..78232 | + | 1311 | WP_046570534.1 | aromatic ring-hydroxylating dioxygenase subunit alpha | - |
NFE55_RS23185 (NFE55_23185) | 78269..79525 | + | 1257 | WP_102857553.1 | hybrid-cluster NAD(P)-dependent oxidoreductase | - |
NFE55_RS23190 (NFE55_23190) | 79668..80525 | + | 858 | WP_028194447.1 | glycine betaine ABC transporter substrate-binding protein | - |
NFE55_RS23195 (NFE55_23195) | 80620..81495 | - | 876 | WP_252890180.1 | formyltetrahydrofolate deformylase | - |
NFE55_RS23200 (NFE55_23200) | 81667..81966 | - | 300 | WP_028194449.1 | putative addiction module antidote protein | Antitoxin |
NFE55_RS23205 (NFE55_23205) | 81970..82269 | - | 300 | WP_028194450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFE55_RS23210 (NFE55_23210) | 82348..83262 | - | 915 | WP_178370025.1 | LysR family transcriptional regulator | - |
NFE55_RS23215 (NFE55_23215) | 83415..84962 | + | 1548 | WP_252890181.1 | choline-sulfatase | - |
NFE55_RS23220 (NFE55_23220) | 85014..85967 | + | 954 | WP_235430069.1 | choline ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 78269..83262 | 4993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11009.69 Da Isoelectric Point: 9.6247
>T249271 WP_028194450.1 NZ_CP099625:c82269-81970 [Paraburkholderia fungorum]
MLKIRTTETFDAWFDGLKDRIARRRIQARIDRLAMGNPGDTNSAGAPIIELRIDHGPGYRVYYVQRGAVLVILLCGGDKS
TQPADIKAAHKMLANLESE
MLKIRTTETFDAWFDGLKDRIARRRIQARIDRLAMGNPGDTNSAGAPIIELRIDHGPGYRVYYVQRGAVLVILLCGGDKS
TQPADIKAAHKMLANLESE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N8Q3W2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D5VNN5 |