Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4717736..4718325 | Replicon | chromosome |
Accession | NZ_CP099623 | ||
Organism | Paraburkholderia fungorum strain OTU2BAGNBA1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1I7EHY9 |
Locus tag | NFE55_RS21165 | Protein ID | WP_028198502.1 |
Coordinates | 4717736..4717918 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0D5V779 |
Locus tag | NFE55_RS21170 | Protein ID | WP_028198501.1 |
Coordinates | 4717915..4718325 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFE55_RS21135 (NFE55_21135) | 4712821..4713510 | - | 690 | WP_235429695.1 | flagellar hook assembly protein FlgD | - |
NFE55_RS21140 (NFE55_21140) | 4713578..4714003 | - | 426 | WP_028198507.1 | flagellar basal body rod protein FlgC | - |
NFE55_RS21145 (NFE55_21145) | 4714174..4714668 | - | 495 | WP_028198506.1 | flagellar basal body rod protein FlgB | - |
NFE55_RS21150 (NFE55_21150) | 4714886..4716346 | + | 1461 | WP_252888526.1 | flagellar basal body P-ring formation chaperone FlgA | - |
NFE55_RS21155 (NFE55_21155) | 4716530..4716886 | + | 357 | WP_028198504.1 | flagellar biosynthesis anti-sigma factor FlgM | - |
NFE55_RS21160 (NFE55_21160) | 4716981..4717427 | + | 447 | WP_028198503.1 | flagellar protein FlgN | - |
NFE55_RS21165 (NFE55_21165) | 4717736..4717918 | + | 183 | WP_028198502.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NFE55_RS21170 (NFE55_21170) | 4717915..4718325 | + | 411 | WP_028198501.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NFE55_RS21175 (NFE55_21175) | 4718390..4719130 | - | 741 | WP_028198500.1 | RNA polymerase sigma factor FliA | - |
NFE55_RS21180 (NFE55_21180) | 4719159..4720028 | - | 870 | WP_028198499.1 | P-loop NTPase | - |
NFE55_RS21185 (NFE55_21185) | 4720021..4721952 | - | 1932 | WP_252888527.1 | flagellar biosynthesis protein FlhF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6569.73 Da Isoelectric Point: 11.3940
>T249270 WP_028198502.1 NZ_CP099623:4717736-4717918 [Paraburkholderia fungorum]
MNSAEVVKVIQADGWRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK
MNSAEVVKVIQADGWRLIRISGSHHHFRHAVKAGLVTIPHPKKDLPPGTLNSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14824.81 Da Isoelectric Point: 4.9474
>AT249270 WP_028198501.1 NZ_CP099623:4717915-4718325 [Paraburkholderia fungorum]
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA
MKNLIFPIAIEPGDTHHAFGVIVPDIPGCHSAGSSLEEAYANAKEAIEAHLDTLLDEGLPIPERLTLEEHRRNPDYAGFT
WGFVTTRNIPALKKAVRINISLPEALVHDIDAYAQARGMSRSAFLALAAEHEMADA
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1I7EHY9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D5V779 |