Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 186579..187252 | Replicon | chromosome |
| Accession | NZ_CP099623 | ||
| Organism | Paraburkholderia fungorum strain OTU2BAGNBA1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U2HB51 |
| Locus tag | NFE55_RS00820 | Protein ID | WP_012431246.1 |
| Coordinates | 186579..186983 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U2H4U0 |
| Locus tag | NFE55_RS00825 | Protein ID | WP_012431247.1 |
| Coordinates | 186980..187252 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFE55_RS00795 (NFE55_00795) | 182386..183813 | + | 1428 | WP_012431241.1 | amidase family protein | - |
| NFE55_RS00800 (NFE55_00800) | 183810..184355 | + | 546 | WP_012431242.1 | amino acid synthesis family protein | - |
| NFE55_RS00805 (NFE55_00805) | 184437..185471 | + | 1035 | WP_012431243.1 | porin | - |
| NFE55_RS00810 (NFE55_00810) | 185723..185965 | + | 243 | WP_012431244.1 | AlpA family transcriptional regulator | - |
| NFE55_RS00815 (NFE55_00815) | 185962..186288 | + | 327 | WP_012431245.1 | hypothetical protein | - |
| NFE55_RS00820 (NFE55_00820) | 186579..186983 | - | 405 | WP_012431246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NFE55_RS00825 (NFE55_00825) | 186980..187252 | - | 273 | WP_012431247.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NFE55_RS00830 (NFE55_00830) | 187779..188651 | + | 873 | WP_012431248.1 | ParA family protein | - |
| NFE55_RS00835 (NFE55_00835) | 188644..189228 | + | 585 | WP_012431249.1 | hypothetical protein | - |
| NFE55_RS00840 (NFE55_00840) | 189225..189902 | + | 678 | WP_012431250.1 | lytic transglycosylase domain-containing protein | - |
| NFE55_RS00845 (NFE55_00845) | 189958..190281 | + | 324 | WP_012431251.1 | TrbC/VirB2 family protein | - |
| NFE55_RS00850 (NFE55_00850) | 190295..190627 | + | 333 | WP_012431252.1 | VirB3 family type IV secretion system protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1515..215914 | 214399 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14466.86 Da Isoelectric Point: 6.4531
>T249268 WP_012431246.1 NZ_CP099623:c186983-186579 [Paraburkholderia fungorum]
MNGYLLDTNVIRDMIRYPSGKVATHIGQIDPRAICTSVVVAAELRYGCARKGSEKLLARVESLLAIIPVLPLDVPADTEY
GGIRAELEIAGQPIGANELLIAAHACALGLTLVTDNTKVFSRIRGLAIENWLDR
MNGYLLDTNVIRDMIRYPSGKVATHIGQIDPRAICTSVVVAAELRYGCARKGSEKLLARVESLLAIIPVLPLDVPADTEY
GGIRAELEIAGQPIGANELLIAAHACALGLTLVTDNTKVFSRIRGLAIENWLDR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|