Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2244238..2244842 | Replicon | chromosome |
Accession | NZ_CP099610 | ||
Organism | Pseudomonas moraviensis strain OTU5VILLAA1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NF674_RS09980 | Protein ID | WP_042609483.1 |
Coordinates | 2244549..2244842 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NF674_RS09975 | Protein ID | WP_042609482.1 |
Coordinates | 2244238..2244546 (-) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF674_RS09950 (NF674_09950) | 2239374..2239997 | + | 624 | WP_016774080.1 | isochorismate family cysteine hydrolase YcaC | - |
NF674_RS09955 (NF674_09955) | 2240209..2241636 | - | 1428 | WP_227974176.1 | mechanosensitive ion channel family protein | - |
NF674_RS09960 (NF674_09960) | 2241745..2242767 | - | 1023 | WP_227974177.1 | alpha/beta hydrolase | - |
NF674_RS09965 (NF674_09965) | 2242928..2243827 | + | 900 | WP_024012435.1 | LysR family transcriptional regulator | - |
NF674_RS09970 (NF674_09970) | 2243899..2244165 | - | 267 | WP_227974502.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NF674_RS09975 (NF674_09975) | 2244238..2244546 | - | 309 | WP_042609482.1 | putative addiction module antidote protein | Antitoxin |
NF674_RS09980 (NF674_09980) | 2244549..2244842 | - | 294 | WP_042609483.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF674_RS09985 (NF674_09985) | 2245070..2245762 | - | 693 | WP_227974178.1 | N-acetyltransferase | - |
NF674_RS09990 (NF674_09990) | 2245759..2246949 | - | 1191 | WP_227974179.1 | GNAT family N-acetyltransferase | - |
NF674_RS09995 (NF674_09995) | 2246954..2247643 | - | 690 | WP_227974180.1 | N-acetyltransferase | - |
NF674_RS10000 (NF674_10000) | 2247705..2249624 | - | 1920 | WP_252875919.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10662.26 Da Isoelectric Point: 10.9839
>T249263 WP_042609483.1 NZ_CP099610:c2244842-2244549 [Pseudomonas moraviensis]
MTYLIQQTAIFHAWHRSIRDLRAKVAIARRIDRASTGNLGDAKSVGDGVSEMRLDVGAGYRVYFTIRNGAVIILLAGGDK
SSQSADIRRAQKMAKEV
MTYLIQQTAIFHAWHRSIRDLRAKVAIARRIDRASTGNLGDAKSVGDGVSEMRLDVGAGYRVYFTIRNGAVIILLAGGDK
SSQSADIRRAQKMAKEV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|