Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 1759623..1760662 | Replicon | chromosome |
| Accession | NZ_CP099609 | ||
| Organism | Pseudomonas moraviensis strain OTU5MASSA1 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | A0A2U1R6X1 |
| Locus tag | NF673_RS07690 | Protein ID | WP_042607561.1 |
| Coordinates | 1759623..1760198 (-) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | - |
| Locus tag | NF673_RS07695 | Protein ID | WP_252881975.1 |
| Coordinates | 1760195..1760662 (-) | Length | 156 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF673_RS07665 (NF673_07665) | 1754964..1756952 | + | 1989 | WP_064365458.1 | heme lyase CcmF/NrfE family subunit | - |
| NF673_RS07670 (NF673_07670) | 1756949..1757485 | + | 537 | WP_064365457.1 | DsbE family thiol:disulfide interchange protein | - |
| NF673_RS07675 (NF673_07675) | 1757482..1757952 | + | 471 | WP_083353299.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF673_RS07680 (NF673_07680) | 1757949..1759148 | + | 1200 | WP_252881526.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF673_RS07685 (NF673_07685) | 1759174..1759578 | + | 405 | WP_042607560.1 | hypothetical protein | - |
| NF673_RS07690 (NF673_07690) | 1759623..1760198 | - | 576 | WP_042607561.1 | PIN domain-containing protein | Toxin |
| NF673_RS07695 (NF673_07695) | 1760195..1760662 | - | 468 | WP_252881975.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NF673_RS07700 (NF673_07700) | 1760847..1761059 | + | 213 | WP_042607563.1 | type II toxin-antitoxin system HicA family toxin | - |
| NF673_RS07705 (NF673_07705) | 1761059..1761463 | + | 405 | WP_227973925.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NF673_RS07710 (NF673_07710) | 1761576..1762775 | - | 1200 | WP_252881527.1 | MFS transporter | - |
| NF673_RS07715 (NF673_07715) | 1763184..1764182 | - | 999 | WP_042607566.1 | sulfate ABC transporter substrate-binding protein | - |
| NF673_RS07720 (NF673_07720) | 1764309..1765133 | - | 825 | WP_042607567.1 | ion transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21608.64 Da Isoelectric Point: 5.8606
>T249252 WP_042607561.1 NZ_CP099609:c1760198-1759623 [Pseudomonas moraviensis]
VRHSSFTAVYDACVLYPAPLRDFLMWLALSGLYRARWTQEIHHEWKRNLLKNRSDLTLEQLDRTSQLMDLAIPDACIDGY
EDLVSGLTLPDENDRHVLAAAIRCGADVIVTFNLKDFPSCHLAPYGIEAQHPDEFVENLFHLDSAAVVAAAQSQRRQLKT
PTVEVDKYLGFLQRQGLVESVKALGNYRAIL
VRHSSFTAVYDACVLYPAPLRDFLMWLALSGLYRARWTQEIHHEWKRNLLKNRSDLTLEQLDRTSQLMDLAIPDACIDGY
EDLVSGLTLPDENDRHVLAAAIRCGADVIVTFNLKDFPSCHLAPYGIEAQHPDEFVENLFHLDSAAVVAAAQSQRRQLKT
PTVEVDKYLGFLQRQGLVESVKALGNYRAIL
Download Length: 576 bp
Antitoxin
Download Length: 156 a.a. Molecular weight: 17278.67 Da Isoelectric Point: 6.3398
>AT249252 WP_252881975.1 NZ_CP099609:c1760662-1760195 [Pseudomonas moraviensis]
MPTPIPSTTNLPVEREVKAAIEGQRTLTAFLATGFDTQRIQIFDEQNEAHSVELPTSALRLLSDILAALAEGNAVKVVPI
HAELTTQEAADLLNVSRPHMIKLLESGEISYHKTGKHRRVRFADLMEYKTRRDTASEQAMRLLAEQAQALRTGYE
MPTPIPSTTNLPVEREVKAAIEGQRTLTAFLATGFDTQRIQIFDEQNEAHSVELPTSALRLLSDILAALAEGNAVKVVPI
HAELTTQEAADLLNVSRPHMIKLLESGEISYHKTGKHRRVRFADLMEYKTRRDTASEQAMRLLAEQAQALRTGYE
Download Length: 468 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|