Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2743635..2744154 | Replicon | chromosome |
Accession | NZ_CP099608 | ||
Organism | Pseudomonas moraviensis strain OTU5BARRA1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NF672_RS12075 | Protein ID | WP_252874460.1 |
Coordinates | 2743873..2744154 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A423NSS0 |
Locus tag | NF672_RS12070 | Protein ID | WP_042610420.1 |
Coordinates | 2743635..2743883 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF672_RS12050 (NF672_12050) | 2739258..2740268 | + | 1011 | WP_252874458.1 | AAA family ATPase | - |
NF672_RS12055 (NF672_12055) | 2740184..2740933 | + | 750 | WP_227974395.1 | VWA domain-containing protein | - |
NF672_RS12060 (NF672_12060) | 2741258..2742817 | + | 1560 | WP_064361773.1 | TerC family protein | - |
NF672_RS12065 (NF672_12065) | 2742955..2743386 | - | 432 | WP_252874459.1 | thioredoxin family protein | - |
NF672_RS12070 (NF672_12070) | 2743635..2743883 | + | 249 | WP_042610420.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NF672_RS12075 (NF672_12075) | 2743873..2744154 | + | 282 | WP_252874460.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF672_RS12080 (NF672_12080) | 2744435..2745283 | + | 849 | WP_064361771.1 | transporter substrate-binding domain-containing protein | - |
NF672_RS12085 (NF672_12085) | 2745335..2745997 | + | 663 | WP_116658545.1 | amino acid ABC transporter permease | - |
NF672_RS12090 (NF672_12090) | 2746007..2746669 | + | 663 | WP_042610356.1 | amino acid ABC transporter permease | - |
NF672_RS12095 (NF672_12095) | 2746666..2747457 | + | 792 | WP_227974399.1 | amino acid ABC transporter ATP-binding protein | - |
NF672_RS12100 (NF672_12100) | 2747489..2747881 | + | 393 | WP_252874461.1 | RidA family protein | - |
NF672_RS12105 (NF672_12105) | 2748090..2748854 | + | 765 | WP_065617205.1 | IclR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10833.64 Da Isoelectric Point: 10.8161
>T249245 WP_252874460.1 NZ_CP099608:2743873-2744154 [Pseudomonas moraviensis]
MTYELEFSDKAWREWGKLGSELREQFKNKLLERLVNPHVPAARLKGLSNAYKIKLRSAGYRLVYRVRDEVLVVTVIAVGK
RQGGDVYRQALKR
MTYELEFSDKAWREWGKLGSELREQFKNKLLERLVNPHVPAARLKGLSNAYKIKLRSAGYRLVYRVRDEVLVVTVIAVGK
RQGGDVYRQALKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|