Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1733769..1734385 | Replicon | chromosome |
| Accession | NZ_CP099608 | ||
| Organism | Pseudomonas moraviensis strain OTU5BARRA1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF672_RS07620 | Protein ID | WP_042607563.1 |
| Coordinates | 1733769..1733981 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A2U1R6P7 |
| Locus tag | NF672_RS07625 | Protein ID | WP_064365452.1 |
| Coordinates | 1733981..1734385 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF672_RS07590 (NF672_07590) | 1729871..1730407 | + | 537 | WP_064365457.1 | DsbE family thiol:disulfide interchange protein | - |
| NF672_RS07595 (NF672_07595) | 1730404..1730874 | + | 471 | WP_064365456.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF672_RS07600 (NF672_07600) | 1730871..1732070 | + | 1200 | WP_042607559.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF672_RS07605 (NF672_07605) | 1732096..1732500 | + | 405 | WP_064365455.1 | hypothetical protein | - |
| NF672_RS07610 (NF672_07610) | 1732545..1733120 | - | 576 | WP_042607561.1 | PIN domain-containing protein | - |
| NF672_RS07615 (NF672_07615) | 1733117..1733584 | - | 468 | WP_042607562.1 | helix-turn-helix domain-containing protein | - |
| NF672_RS07620 (NF672_07620) | 1733769..1733981 | + | 213 | WP_042607563.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF672_RS07625 (NF672_07625) | 1733981..1734385 | + | 405 | WP_064365452.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF672_RS07630 (NF672_07630) | 1734498..1735697 | - | 1200 | WP_252874094.1 | MFS transporter | - |
| NF672_RS07635 (NF672_07635) | 1736106..1737104 | - | 999 | WP_042607566.1 | sulfate ABC transporter substrate-binding protein | - |
| NF672_RS07640 (NF672_07640) | 1737281..1738105 | - | 825 | WP_064365449.1 | ion transporter | - |
| NF672_RS07645 (NF672_07645) | 1738127..1739041 | - | 915 | WP_252874095.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7907.02 Da Isoelectric Point: 10.5973
>T249243 WP_042607563.1 NZ_CP099608:1733769-1733981 [Pseudomonas moraviensis]
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVTSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVTSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14677.72 Da Isoelectric Point: 4.6956
>AT249243 WP_064365452.1 NZ_CP099608:1733981-1734385 [Pseudomonas moraviensis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRSHPDFAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRSHPDFAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|