Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1470234..1470856 | Replicon | chromosome |
| Accession | NZ_CP099608 | ||
| Organism | Pseudomonas moraviensis strain OTU5BARRA1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF672_RS06425 | Protein ID | WP_082367752.1 |
| Coordinates | 1470677..1470856 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A2U1RCR8 |
| Locus tag | NF672_RS06420 | Protein ID | WP_064362606.1 |
| Coordinates | 1470234..1470641 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF672_RS06385 (NF672_06385) | 1465653..1466156 | + | 504 | WP_252874029.1 | DUF4142 domain-containing protein | - |
| NF672_RS06390 (NF672_06390) | 1466327..1466737 | - | 411 | WP_016771301.1 | low affinity iron permease family protein | - |
| NF672_RS06395 (NF672_06395) | 1466914..1467684 | + | 771 | WP_252874030.1 | trans-aconitate 2-methyltransferase | - |
| NF672_RS06400 (NF672_06400) | 1467815..1468543 | - | 729 | WP_252874031.1 | class I SAM-dependent methyltransferase | - |
| NF672_RS06405 (NF672_06405) | 1468973..1469332 | + | 360 | WP_039760852.1 | DUF6124 family protein | - |
| NF672_RS06410 (NF672_06410) | 1469400..1469756 | - | 357 | WP_042608155.1 | transcriptional regulator | - |
| NF672_RS06415 (NF672_06415) | 1469756..1470058 | - | 303 | WP_065615204.1 | type II toxin-antitoxin system HigB family toxin | - |
| NF672_RS06420 (NF672_06420) | 1470234..1470641 | - | 408 | WP_064362606.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF672_RS06425 (NF672_06425) | 1470677..1470856 | - | 180 | WP_082367752.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF672_RS06435 (NF672_06435) | 1471526..1472410 | - | 885 | WP_064362603.1 | alpha/beta hydrolase | - |
| NF672_RS06440 (NF672_06440) | 1472727..1473419 | - | 693 | WP_252874032.1 | pseudouridine synthase | - |
| NF672_RS06445 (NF672_06445) | 1473453..1473683 | - | 231 | WP_252874033.1 | cysteine-rich CWC family protein | - |
| NF672_RS06450 (NF672_06450) | 1473676..1475163 | - | 1488 | WP_042608152.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1465653..1470856 | 5203 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6662.95 Da Isoelectric Point: 11.8222
>T249241 WP_082367752.1 NZ_CP099608:c1470856-1470677 [Pseudomonas moraviensis]
VNSRFLIGQLVADGWFLVRIRGSHHHFKHPTKPGLVTVPHPKKDLLKKTAVSILQQAML
VNSRFLIGQLVADGWFLVRIRGSHHHFKHPTKPGLVTVPHPKKDLLKKTAVSILQQAML
Download Length: 180 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14567.59 Da Isoelectric Point: 4.5117
>AT249241 WP_064362606.1 NZ_CP099608:c1470641-1470234 [Pseudomonas moraviensis]
MLYPIAISIGDEEHAWGVEVPDLPGCFSAGEDLDDAVAMAREAIEGHFEILADDDAPIPPASKLSLHVANPKYAGCAWAV
VDIDVVKYLGKAQKLNITLPGHLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQG
MLYPIAISIGDEEHAWGVEVPDLPGCFSAGEDLDDAVAMAREAIEGHFEILADDDAPIPPASKLSLHVANPKYAGCAWAV
VDIDVVKYLGKAQKLNITLPGHLLNRIDEYVLHHPEEKSRSGFLASAALKVLQQG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|