Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
Location | 3112781..3113309 | Replicon | chromosome |
Accession | NZ_CP099602 | ||
Organism | Pseudomonas siliginis strain OTU6MONTID1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A554AHL9 |
Locus tag | NF680_RS13945 | Protein ID | WP_041480302.1 |
Coordinates | 3113019..3113309 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A341F4V9 |
Locus tag | NF680_RS13940 | Protein ID | WP_016770738.1 |
Coordinates | 3112781..3113026 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF680_RS13915 (NF680_13915) | 3108414..3109709 | + | 1296 | WP_252876351.1 | OprD family porin | - |
NF680_RS13920 (NF680_13920) | 3109936..3110589 | + | 654 | WP_150635200.1 | hypothetical protein | - |
NF680_RS13925 (NF680_13925) | 3110586..3111101 | + | 516 | WP_252867657.1 | hypothetical protein | - |
NF680_RS13930 (NF680_13930) | 3111110..3111619 | + | 510 | WP_016774812.1 | hypothetical protein | - |
NF680_RS13935 (NF680_13935) | 3112080..3112439 | + | 360 | WP_150635198.1 | DUF6124 family protein | - |
NF680_RS13940 (NF680_13940) | 3112781..3113026 | + | 246 | WP_016770738.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NF680_RS13945 (NF680_13945) | 3113019..3113309 | + | 291 | WP_041480302.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF680_RS13955 (NF680_13955) | 3113510..3115426 | - | 1917 | Protein_2752 | selenocysteine-specific translation elongation factor | - |
NF680_RS13960 (NF680_13960) | 3115423..3116835 | - | 1413 | WP_252876352.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11136.67 Da Isoelectric Point: 5.6837
>T249236 WP_041480302.1 NZ_CP099602:3113019-3113309 [Pseudomonas siliginis]
MAEYRLTPAAEADLEAIWTYTAQQWGLDQANRYIDILTESFEQLADRPKTAPACDAIRPGYRRCSVESHMIYFRITAYGI
AIIRILHDRMEAQRNL
MAEYRLTPAAEADLEAIWTYTAQQWGLDQANRYIDILTESFEQLADRPKTAPACDAIRPGYRRCSVESHMIYFRITAYGI
AIIRILHDRMEAQRNL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A554AHL9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A341F4V9 |