Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1786462..1787078 | Replicon | chromosome |
| Accession | NZ_CP099602 | ||
| Organism | Pseudomonas siliginis strain OTU6MONTID1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NF680_RS07945 | Protein ID | WP_076566640.1 |
| Coordinates | 1786462..1786674 (+) | Length | 71 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | V8RA99 |
| Locus tag | NF680_RS07950 | Protein ID | WP_016771035.1 |
| Coordinates | 1786674..1787078 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF680_RS07915 (NF680_07915) | 1782563..1783099 | + | 537 | WP_016771042.1 | DsbE family thiol:disulfide interchange protein | - |
| NF680_RS07920 (NF680_07920) | 1783096..1783566 | + | 471 | WP_016771041.1 | cytochrome c-type biogenesis protein CcmH | - |
| NF680_RS07925 (NF680_07925) | 1783563..1784762 | + | 1200 | WP_252877696.1 | c-type cytochrome biogenesis protein CcmI | - |
| NF680_RS07930 (NF680_07930) | 1784788..1785192 | + | 405 | WP_016771039.1 | hypothetical protein | - |
| NF680_RS07935 (NF680_07935) | 1785239..1785814 | - | 576 | WP_252877697.1 | PIN domain-containing protein | - |
| NF680_RS07940 (NF680_07940) | 1785811..1786278 | - | 468 | WP_129999052.1 | helix-turn-helix domain-containing protein | - |
| NF680_RS07945 (NF680_07945) | 1786462..1786674 | + | 213 | WP_076566640.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NF680_RS07950 (NF680_07950) | 1786674..1787078 | + | 405 | WP_016771035.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NF680_RS07955 (NF680_07955) | 1787191..1788390 | - | 1200 | WP_236169678.1 | MFS transporter | - |
| NF680_RS07960 (NF680_07960) | 1788558..1789556 | - | 999 | WP_056783861.1 | sulfate ABC transporter substrate-binding protein | - |
| NF680_RS07965 (NF680_07965) | 1789661..1790485 | - | 825 | WP_041479613.1 | ion transporter | - |
| NF680_RS07970 (NF680_07970) | 1790507..1791421 | - | 915 | WP_252869021.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7934.09 Da Isoelectric Point: 10.8102
>T249234 WP_076566640.1 NZ_CP099602:1786462-1786674 [Pseudomonas siliginis]
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHHIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.81 Da Isoelectric Point: 4.5789
>AT249234 WP_016771035.1 NZ_CP099602:1786674-1787078 [Pseudomonas siliginis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAHLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|