Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
Location | 474994..475625 | Replicon | chromosome |
Accession | NZ_CP099602 | ||
Organism | Pseudomonas siliginis strain OTU6MONTID1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NF680_RS02080 | Protein ID | WP_252877298.1 |
Coordinates | 475263..475625 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | J2YH56 |
Locus tag | NF680_RS02075 | Protein ID | WP_008077592.1 |
Coordinates | 474994..475263 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF680_RS02040 (NF680_02040) | 470493..471038 | - | 546 | WP_252877297.1 | hypothetical protein | - |
NF680_RS02045 (NF680_02045) | 471035..471289 | - | 255 | WP_056787400.1 | acyl carrier protein | - |
NF680_RS02050 (NF680_02050) | 471299..471574 | - | 276 | WP_095181011.1 | phosphopantetheine-binding protein | - |
NF680_RS02055 (NF680_02055) | 471552..472364 | - | 813 | WP_041477597.1 | lysophospholipid acyltransferase family protein | - |
NF680_RS02060 (NF680_02060) | 472340..473065 | - | 726 | WP_041477598.1 | beta-ketoacyl synthase chain length factor | - |
NF680_RS02065 (NF680_02065) | 473422..474192 | + | 771 | WP_056787407.1 | ParA family protein | - |
NF680_RS02070 (NF680_02070) | 474323..474757 | - | 435 | WP_095181008.1 | thioredoxin TrxC | - |
NF680_RS02075 (NF680_02075) | 474994..475263 | + | 270 | WP_008077592.1 | hypothetical protein | Antitoxin |
NF680_RS02080 (NF680_02080) | 475263..475625 | + | 363 | WP_252877298.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NF680_RS02085 (NF680_02085) | 475631..477094 | - | 1464 | WP_252877299.1 | YdiU family protein | - |
NF680_RS02090 (NF680_02090) | 477143..480496 | - | 3354 | WP_252877300.1 | mechanosensitive channel MscK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13400.33 Da Isoelectric Point: 7.1665
>T249232 WP_252877298.1 NZ_CP099602:475263-475625 [Pseudomonas siliginis]
MVRRQPPQRGDVYWIDPNPVAGREMMNRHRFVVITPREINALGVSMTVPITSGGNFSRYMGLAVAITGHETNGVAVCNQV
RSFDIEQRVRDGTAKFIERLDDVTMSDIVDRVISAIDPLS
MVRRQPPQRGDVYWIDPNPVAGREMMNRHRFVVITPREINALGVSMTVPITSGGNFSRYMGLAVAITGHETNGVAVCNQV
RSFDIEQRVRDGTAKFIERLDDVTMSDIVDRVISAIDPLS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|