Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 321666..322294 Replicon chromosome
Accession NZ_CP099602
Organism Pseudomonas siliginis strain OTU6MONTID1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NF680_RS01395 Protein ID WP_150637947.1
Coordinates 321666..322064 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID V8RDT4
Locus tag NF680_RS01400 Protein ID WP_024011210.1
Coordinates 322064..322294 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NF680_RS01375 (NF680_01375) 317340..318035 - 696 WP_016772144.1 ABC transporter permease -
NF680_RS01380 (NF680_01380) 318113..318865 - 753 WP_095181077.1 ABC transporter substrate-binding protein -
NF680_RS01385 (NF680_01385) 318879..319652 - 774 WP_236168220.1 ABC transporter ATP-binding protein -
NF680_RS01390 (NF680_01390) 320196..321587 + 1392 WP_150637946.1 GABA permease -
NF680_RS01395 (NF680_01395) 321666..322064 - 399 WP_150637947.1 tRNA(fMet)-specific endonuclease VapC Toxin
NF680_RS01400 (NF680_01400) 322064..322294 - 231 WP_024011210.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NF680_RS01405 (NF680_01405) 322460..322912 - 453 WP_056787197.1 hypothetical protein -
NF680_RS01410 (NF680_01410) 322919..323332 - 414 WP_150637948.1 hypothetical protein -
NF680_RS01415 (NF680_01415) 323362..324303 - 942 WP_252877258.1 alpha/beta fold hydrolase -
NF680_RS01420 (NF680_01420) 324336..324620 + 285 WP_133337418.1 hypothetical protein -
NF680_RS01425 (NF680_01425) 324638..324928 + 291 WP_252868627.1 YceK/YidQ family lipoprotein -
NF680_RS01430 (NF680_01430) 324941..325288 - 348 WP_252868628.1 hypothetical protein -
NF680_RS01435 (NF680_01435) 325311..326789 - 1479 WP_252877259.1 PLP-dependent aminotransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 312135..322294 10159


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14548.91 Da        Isoelectric Point: 6.4602

>T249231 WP_150637947.1 NZ_CP099602:c322064-321666 [Pseudomonas siliginis]
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFERVSGLRIEDWV

Download         Length: 399 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8588.62 Da        Isoelectric Point: 4.5203

>AT249231 WP_024011210.1 NZ_CP099602:c322294-322064 [Pseudomonas siliginis]
MEQTTIFMSNRSQAVRLPKAVAMPGDVKRVEVIAIGRTRVITPAGESWDSWFDGDSVSPDFMANREQPTEQERESF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB V8RDT4

References