Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 321666..322294 | Replicon | chromosome |
| Accession | NZ_CP099602 | ||
| Organism | Pseudomonas siliginis strain OTU6MONTID1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NF680_RS01395 | Protein ID | WP_150637947.1 |
| Coordinates | 321666..322064 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V8RDT4 |
| Locus tag | NF680_RS01400 | Protein ID | WP_024011210.1 |
| Coordinates | 322064..322294 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF680_RS01375 (NF680_01375) | 317340..318035 | - | 696 | WP_016772144.1 | ABC transporter permease | - |
| NF680_RS01380 (NF680_01380) | 318113..318865 | - | 753 | WP_095181077.1 | ABC transporter substrate-binding protein | - |
| NF680_RS01385 (NF680_01385) | 318879..319652 | - | 774 | WP_236168220.1 | ABC transporter ATP-binding protein | - |
| NF680_RS01390 (NF680_01390) | 320196..321587 | + | 1392 | WP_150637946.1 | GABA permease | - |
| NF680_RS01395 (NF680_01395) | 321666..322064 | - | 399 | WP_150637947.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NF680_RS01400 (NF680_01400) | 322064..322294 | - | 231 | WP_024011210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NF680_RS01405 (NF680_01405) | 322460..322912 | - | 453 | WP_056787197.1 | hypothetical protein | - |
| NF680_RS01410 (NF680_01410) | 322919..323332 | - | 414 | WP_150637948.1 | hypothetical protein | - |
| NF680_RS01415 (NF680_01415) | 323362..324303 | - | 942 | WP_252877258.1 | alpha/beta fold hydrolase | - |
| NF680_RS01420 (NF680_01420) | 324336..324620 | + | 285 | WP_133337418.1 | hypothetical protein | - |
| NF680_RS01425 (NF680_01425) | 324638..324928 | + | 291 | WP_252868627.1 | YceK/YidQ family lipoprotein | - |
| NF680_RS01430 (NF680_01430) | 324941..325288 | - | 348 | WP_252868628.1 | hypothetical protein | - |
| NF680_RS01435 (NF680_01435) | 325311..326789 | - | 1479 | WP_252877259.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 312135..322294 | 10159 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14548.91 Da Isoelectric Point: 6.4602
>T249231 WP_150637947.1 NZ_CP099602:c322064-321666 [Pseudomonas siliginis]
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFERVSGLRIEDWV
MIKYMLDTNICIFTIKNKPQIVREAFNRHSGQLCISAITLMELIYGAEKSAAPEKNLAIVEGFVARLDVLPFDNDAAAQA
GMVRSELAKAGTPIGPYDQMIAGHARSLGLIVVTNNVREFERVSGLRIEDWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|