Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 174068..174584 | Replicon | chromosome |
Accession | NZ_CP099602 | ||
Organism | Pseudomonas siliginis strain OTU6MONTID1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NF680_RS00735 | Protein ID | WP_252877214.1 |
Coordinates | 174303..174584 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2U1R4X8 |
Locus tag | NF680_RS00730 | Protein ID | WP_041477418.1 |
Coordinates | 174068..174313 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF680_RS00710 (NF680_00710) | 169429..170967 | + | 1539 | WP_252877212.1 | MFS transporter | - |
NF680_RS00715 (NF680_00715) | 170995..172062 | + | 1068 | WP_150637840.1 | HlyD family secretion protein | - |
NF680_RS00720 (NF680_00720) | 172059..173654 | + | 1596 | WP_252877213.1 | efflux transporter outer membrane subunit | - |
NF680_RS00725 (NF680_00725) | 173733..173978 | + | 246 | WP_252868578.1 | DUF2789 domain-containing protein | - |
NF680_RS00730 (NF680_00730) | 174068..174313 | + | 246 | WP_041477418.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NF680_RS00735 (NF680_00735) | 174303..174584 | + | 282 | WP_252877214.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF680_RS00740 (NF680_00740) | 174948..175376 | + | 429 | WP_016772266.1 | winged helix DNA-binding protein | - |
NF680_RS00745 (NF680_00745) | 175373..177436 | + | 2064 | WP_150637842.1 | FUSC family protein | - |
NF680_RS00750 (NF680_00750) | 177433..177642 | + | 210 | WP_016772264.1 | DUF1656 domain-containing protein | - |
NF680_RS00755 (NF680_00755) | 177639..178526 | + | 888 | WP_252877215.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10812.70 Da Isoelectric Point: 10.5812
>T249230 WP_252877214.1 NZ_CP099602:174303-174584 [Pseudomonas siliginis]
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
MTYKLEFLPSAHKEWNKLGHTLREQFKKKLGERLKLPRIPADALHGMPDCYKIKLKASGYRLVYQVIDERVVVSVLAVGK
RERSSVYDAARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|