Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
| Location | 3085962..3086490 | Replicon | chromosome |
| Accession | NZ_CP099601 | ||
| Organism | Pseudomonas siliginis strain OTU6MONEA1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A554AHL9 |
| Locus tag | NF679_RS13785 | Protein ID | WP_041480302.1 |
| Coordinates | 3086200..3086490 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A341F4V9 |
| Locus tag | NF679_RS13780 | Protein ID | WP_016770738.1 |
| Coordinates | 3085962..3086207 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF679_RS13755 (NF679_13755) | 3081580..3082890 | + | 1311 | WP_252867656.1 | OprD family porin | - |
| NF679_RS13760 (NF679_13760) | 3083117..3083770 | + | 654 | WP_150635200.1 | hypothetical protein | - |
| NF679_RS13765 (NF679_13765) | 3083767..3084282 | + | 516 | WP_252867657.1 | hypothetical protein | - |
| NF679_RS13770 (NF679_13770) | 3084291..3084800 | + | 510 | WP_016774812.1 | hypothetical protein | - |
| NF679_RS13775 (NF679_13775) | 3085261..3085620 | + | 360 | WP_150635198.1 | DUF6124 family protein | - |
| NF679_RS13780 (NF679_13780) | 3085962..3086207 | + | 246 | WP_016770738.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| NF679_RS13785 (NF679_13785) | 3086200..3086490 | + | 291 | WP_041480302.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF679_RS13795 (NF679_13795) | 3086691..3088607 | - | 1917 | WP_252869552.1 | selenocysteine-specific translation elongation factor | - |
| NF679_RS13800 (NF679_13800) | 3088604..3090016 | - | 1413 | WP_252867658.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11136.67 Da Isoelectric Point: 5.6837
>T249227 WP_041480302.1 NZ_CP099601:3086200-3086490 [Pseudomonas siliginis]
MAEYRLTPAAEADLEAIWTYTAQQWGLDQANRYIDILTESFEQLADRPKTAPACDAIRPGYRRCSVESHMIYFRITAYGI
AIIRILHDRMEAQRNL
MAEYRLTPAAEADLEAIWTYTAQQWGLDQANRYIDILTESFEQLADRPKTAPACDAIRPGYRRCSVESHMIYFRITAYGI
AIIRILHDRMEAQRNL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A554AHL9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A341F4V9 |