Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1723955..1724571 | Replicon | chromosome |
Accession | NZ_CP099601 | ||
Organism | Pseudomonas siliginis strain OTU6MONEA1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NF679_RS07585 | Protein ID | WP_041479616.1 |
Coordinates | 1723955..1724167 (+) | Length | 71 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NF679_RS07590 | Protein ID | WP_252869018.1 |
Coordinates | 1724167..1724571 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF679_RS07555 (NF679_07555) | 1720057..1720593 | + | 537 | WP_024012128.1 | DsbE family thiol:disulfide interchange protein | - |
NF679_RS07560 (NF679_07560) | 1720590..1721060 | + | 471 | WP_252869016.1 | cytochrome c-type biogenesis protein CcmH | - |
NF679_RS07565 (NF679_07565) | 1721057..1722256 | + | 1200 | WP_056783853.1 | c-type cytochrome biogenesis protein CcmI | - |
NF679_RS07570 (NF679_07570) | 1722282..1722686 | + | 405 | WP_252869017.1 | hypothetical protein | - |
NF679_RS07575 (NF679_07575) | 1722732..1723306 | - | 575 | Protein_1494 | PIN domain-containing protein | - |
NF679_RS07580 (NF679_07580) | 1723303..1723770 | - | 468 | WP_056783858.1 | helix-turn-helix domain-containing protein | - |
NF679_RS07585 (NF679_07585) | 1723955..1724167 | + | 213 | WP_041479616.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NF679_RS07590 (NF679_07590) | 1724167..1724571 | + | 405 | WP_252869018.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NF679_RS07595 (NF679_07595) | 1724684..1725883 | - | 1200 | WP_252869019.1 | MFS transporter | - |
NF679_RS07600 (NF679_07600) | 1726050..1727048 | - | 999 | WP_056783861.1 | sulfate ABC transporter substrate-binding protein | - |
NF679_RS07605 (NF679_07605) | 1727153..1727977 | - | 825 | WP_252869020.1 | ion transporter | - |
NF679_RS07610 (NF679_07610) | 1727999..1728913 | - | 915 | WP_252869021.1 | urea transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7960.12 Da Isoelectric Point: 10.5523
>T249225 WP_041479616.1 NZ_CP099601:1723955-1724167 [Pseudomonas siliginis]
VQSRLLMKELEEAGWTLDRVAGSHYIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
VQSRLLMKELEEAGWTLDRVAGSHYIFTHRYNPNTIAVPHPKKDLPLGTVKSIRRRAGLFSPPTRHEGDP
Download Length: 213 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14802.84 Da Isoelectric Point: 4.4537
>AT249225 WP_252869018.1 NZ_CP099601:1724167-1724571 [Pseudomonas siliginis]
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAYLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
MQYPICIEWGDENTAIGIQIPDIPGAVTAGDSFEEAYNAAVEVAYLMLQEIAAAGQAIPMPTSAAAHRNHPDFAEMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHNVKSRSSFLADAAMEKLVRY
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|