Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
| Location | 470439..471070 | Replicon | chromosome |
| Accession | NZ_CP099601 | ||
| Organism | Pseudomonas siliginis strain OTU6MONEA1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NF679_RS02080 | Protein ID | WP_252868668.1 |
| Coordinates | 470708..471070 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | J2YH56 |
| Locus tag | NF679_RS02075 | Protein ID | WP_008077592.1 |
| Coordinates | 470439..470708 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF679_RS02040 (NF679_02040) | 465936..466481 | - | 546 | WP_252868667.1 | hypothetical protein | - |
| NF679_RS02045 (NF679_02045) | 466478..466732 | - | 255 | WP_056787400.1 | acyl carrier protein | - |
| NF679_RS02050 (NF679_02050) | 466742..467017 | - | 276 | WP_095181011.1 | phosphopantetheine-binding protein | - |
| NF679_RS02055 (NF679_02055) | 466995..467807 | - | 813 | WP_041477597.1 | lysophospholipid acyltransferase family protein | - |
| NF679_RS02060 (NF679_02060) | 467783..468508 | - | 726 | WP_041477598.1 | beta-ketoacyl synthase chain length factor | - |
| NF679_RS02065 (NF679_02065) | 468865..469635 | + | 771 | WP_056787407.1 | ParA family protein | - |
| NF679_RS02070 (NF679_02070) | 469768..470202 | - | 435 | WP_095181008.1 | thioredoxin TrxC | - |
| NF679_RS02075 (NF679_02075) | 470439..470708 | + | 270 | WP_008077592.1 | hypothetical protein | Antitoxin |
| NF679_RS02080 (NF679_02080) | 470708..471070 | + | 363 | WP_252868668.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NF679_RS02085 (NF679_02085) | 471076..472539 | - | 1464 | WP_252868669.1 | YdiU family protein | - |
| NF679_RS02090 (NF679_02090) | 472588..475941 | - | 3354 | WP_252868670.1 | mechanosensitive channel MscK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13434.40 Da Isoelectric Point: 8.0357
>T249223 WP_252868668.1 NZ_CP099601:470708-471070 [Pseudomonas siliginis]
MVRRQPPQRGDVYWIDPNPVAGREMMNRHRFVVITPREINALGVSMTVPVTSGGNFSRYMGLAVAITGHETNGVAVCNQV
RSFDIEQRVRYGTAKFIERLDDVTMSDIVDRVISAIDPLS
MVRRQPPQRGDVYWIDPNPVAGREMMNRHRFVVITPREINALGVSMTVPVTSGGNFSRYMGLAVAITGHETNGVAVCNQV
RSFDIEQRVRYGTAKFIERLDDVTMSDIVDRVISAIDPLS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|